KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345071Help
Entry
4345071           CDS       T01015                                 

Definition
Os08g0248800
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    4345071
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4345071
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     4345071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 363 aa AA seqDB search
MAAARATLPLPRVPAPSPRPQLRPFPSLPARRGAVACGAGSAAAGVAASLRLGDVIEAQQ
FDRDALTEIFEVAREMEALERGSSSRGAGRSRVLEGYLMATLFYEPSTRTRLSFEAAMRR
LGGEVLTTENAREFSSAAKGETLEDTIRTVEGYSDIIVLRHFESGAARRAAATADIPVIN
AGDGPGQHPTQALLDVYSIEREIGTLDGIKLGLVGDLANGRTVRSLAYLIAKYQNIKIYF
VSPDVVKMKDDIKEYLTSQGVEWEESSDLLEVASKCDVIYQTRIQKERFGERIDLYEAAR
GKYIVDKKVLDVLPKHAVIMHPLPRLDEITIDVDSDPRAAYFRQAKNGLYIRMALLKLLL
VGR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcccgcgccaccctcccgctcccgcgtgtccccgccccctcgccgaggccc
cagctcaggcccttcccctccctccccgctcgccgcggcgcggtggcatgcggcgccggc
tcggcggcggcgggggtcgcggcgtcgctgcggctcggggacgtgatcgaggcgcagcag
ttcgaccgggacgcgctgacggagatcttcgaggtggcgcgggagatggaggccctggag
cgcgggtcctcctcccgcggcgccgggaggagccgcgtcctcgaggggtacctcatggcc
acgctcttctatgagccgtccacgcgcacgcgcctctccttcgaggccgccatgcggcgg
ctcggcggggaggtgctcaccaccgagaacgcccgcgagttctcctccgccgccaagggc
gagaccctggaagataccataaggactgttgagggttattctgatattattgttctgaga
cattttgaaagtggggctgcaaggagagcagccgccactgcagacattccagttattaat
gcaggcgatgggccagggcaacatccaactcaggctttattggatgtctattcaatagag
agagaaattggcacactagatggaataaaacttggtttggttggagaccttgctaatgga
agaactgttcgttctctagcctatttgattgccaaataccaaaacattaagatatacttt
gtatctccagatgttgtaaaaatgaaggatgacatcaaggaatacttaacttctcaaggt
gttgagtgggaagaaagttcagatttgttggaggtggcatcaaaatgcgatgttatttat
caaacacgcattcaaaaagaaagattcggtgagaggatagatctttatgaagcagctcgt
ggtaagtacattgtggacaagaaggtcttagatgtgctgccaaaacatgctgttatcatg
catccccttccaaggcttgatgagatcacaatagatgttgacagtgatccgagagctgca
tattttagacaggccaaaaacggcctctacatcagaatggcgttgctcaaacttctgctt
gttggtcgctga

DBGET integrated database retrieval system