KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345225Help
Entry
4345225           CDS       T01015                                 

Definition
Os08g0304900
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:osa03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 409 aa AA seqDB search
MPELPEVEVARRALEEHCVGKRIVRCSAADDTKVIDGVAPPRLEAALVGRTISAARRKGK
NLWLALDSPPFPSFQFGMAGAIYIKGVELSKYKRSAVSPTEEWPLKYSKLLVVMDDGLEF
SFTDKRRFAKIRFLDNPEAVPPISELGPDALFEPLHLDDFVESLSRKKAPIKALLLDQSF
ISGIGNWIADEVLYQARIHPMQTASMISKEKCKALHQCIIEVIEKSLEVGCNSSQYPENW
IFHSREKKPGKKIDFITVGGRTSAYVPELQKLDGIDATASRAKISKEQSKSNKAAREVDD
DEEEAKPAKRGRKQLVKATHEIQEDEEDTKESKRGRKQPAKTSKGSWKKAHHSSEGSGDD
DSDDEAVDKVVAEQGKRRDPKQPAEAKSSSDKGGSAAPAKRPQRKKRQL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgccggaggtggaggtggcgcgacgggcgctggaggagcactgcgtcggg
aagaggatcgtgcggtgctcggctgcagatgacaccaaggtcatcgacggcgtcgccccg
ccgcggctggaggcagcgcttgtcgggaggaccatctccgctgctcgccgcaagggcaag
aatctgtggcttgcgcttgattctccgcccttcccttccttccagttcggaatggctgga
gctatttacatcaagggtgtggaactgagcaaatacaaaaggtctgcagtgagcccgact
gaggaatggcctttgaagtattccaagctgcttgttgtaatggatgatggtttggagttt
tccttcactgataagaggcgttttgcaaaaattcgctttcttgacaatccagaagctgtc
ccaccaatttctgagcttggaccagatgccttatttgaacctcttcatcttgatgatttt
gtagagtcactaagtaggaaaaaagctccaataaaagcccttttgcttgatcagagcttt
atatcaggaattggcaattggattgcagatgaagtgctttatcaggcaaggattcatcca
atgcaaacagcatcgatgatttctaaggagaaatgcaaggcactccatcagtgcattata
gaggtgattgaaaagtccttagaagttggttgcaacagcagtcagtatccagaaaactgg
atatttcactccagggagaagaaacccgggaagaaaattgacttcattacagttggtggc
aggacttcagcatatgtgccagagttgcagaagctggacgggattgatgcaacagcaagc
agagcgaaaataagcaaagaacagagcaaatcaaataaagctgctcgtgaagtggacgat
gatgaggaagaggctaaacctgccaagaggggaaggaagcaattagtgaaggcaacccat
gagatccaagaggatgaggaagatacaaaagaatcaaagagaggaaggaagcaaccagca
aagacatcgaagggctcgtggaagaaagctcatcattcttctgagggtagtggtgacgac
gacagtgatgatgaagcagttgataaggtggtcgcggaacaagggaagaggagggatcca
aagcaaccagcagaggcgaaaagctcgtcagacaaaggaggaagtgctgccccagcaaag
aggccacagaggaagaagcggcaattatag

DBGET integrated database retrieval system