KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345675Help
Entry
4345675           CDS       T01015                                 

Definition
Os08g0439000
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:osa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:osa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:osa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:osa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:osa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:osa00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 489 aa AA seqDB search
MAVSLKSSGSFCSTPPQWLHSTRDRILYGYSHSNAKECTCKKTKRPAPLCVKATSTKVEL
DFNDPSWKQKFQEDWDKRFNLPRITDIYDLKPRPTTFSLKKNRSPAGDENGTPMDKWNGY
VNSDDRALLKVIKYSSPNSAGAECIDPDCSWVEQWVHRAGPRKEIYYEPEEVKAAIVTCG
GLCPGLNDVIRQIVFTLETYGVKNIVGIPFGYRGFFEKGLKEMPLSRHLVENINLAGGSF
LGVSRGGAKTSEIVDSIQARRIDMLFVLGGNGTHAGANAIHEECRKRKLKVSVVAVPKTI
DNDILLMDKTFGFDTAVEEAQRAINSAYIEVPFTLDGEYGVLRHLEHLLKTKGFCVVCVA
EAAGQIQLEARATDASGNVILSDIGVHMQQKIKMHFKDIGVPADVKYIDPTYMVRACRAN
ASDAILCTVLGQNAVHGAFAGFSGITSCICNTHYVYLPITEVITVPKRVNPNSRMWHRCL
TSTGQPDFH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttctttaaaatcaagtggcagtttttgtagcacaccgcctcagtggctgcat
tcaacaagggatcgaattttatacggttattctcattcaaatgccaaagagtgcacttgc
aagaaaacaaaaaggcctgctccactgtgtgttaaagctacttccacgaaagtggaatta
gatttcaatgatccatcttggaagcagaagtttcaggaagactgggataaacgttttaat
ttgccacgtattacagacatatatgatttgaaaccaaggccaaccacattctcactcaag
aaaaacagaagtcctgcaggtgatgaaaatggtacacctatggataaatggaatggttat
gtgaacagcgatgatcgagcacttttgaaggtgataaagtattcctcgcctaactctgct
ggagcagagtgcattgatcctgactgtagctgggtggaacaatgggtacatcgtgcaggc
cctcgtaaggagatatactatgaaccagaggaagtaaaagctgccatagttacttgtgga
gggctctgccctggtttgaacgatgtcatcagacagatagtattcactctagagacctat
ggggttaagaatattgttgggattccatttggttatcgtggattttttgaaaagggccta
aaagaaatgccactttcacgtcatctggtggagaacataaatcttgctggtggaagtttt
ctaggagtctctcgtggaggagctaaaactagtgagattgtagatagtatacaggccaga
agaattgatatgcttttcgtgcttggaggaaatggtacccatgcaggagcaaatgctatc
catgaagagtgccggaagagaaagctaaaagtttcagttgtagcagttccaaagaccatc
gacaatgatatacttttgatggacaaaacatttggtttcgatacggctgttgaagaagct
cagcgggccattaattctgcatatatagaggttcctttcacgcttgatggagaatatggt
gttctacgacaccttgagcatttgttaaagaccaaaggattctgtgttgtttgtgttgct
gaagctgcaggacaaatacagctggaagcacgtgcaacagatgcatctggaaatgtgata
cttagtgacatcggtgttcatatgcaacagaagattaagatgcatttcaaggacattggt
gttcctgctgatgtaaaatacattgatccgacatatatggttcgggcatgtcgtgccaat
gcatctgatgcaattttgtgcactgtacttggacaaaatgctgtccatggagcatttgct
gggttcagtggcatcacttcttgcatctgcaacacgcactacgtctacctccccatcaca
gaagtcataacagtaccgaagcgcgtgaaccctaatagcaggatgtggcaccgttgccta
acgtccactggccagcctgatttccattga

DBGET integrated database retrieval system