KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345904Help
Entry
4345904           CDS       T01015                                 

Definition
Os08g0490900
Orthology
K11252  
histone H2B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4345904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 150 aa AA seqDB search
MAPKAEKKPAEKKPAEEKAGEKAPAAGKKPKAEKRLPASKGEKGGEGKKERGRKKAKKSV
ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGEAAKLARYNKKPTITSREI
QTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggccgagaagaagcccgcggagaagaagccggcggaggagaaggccggc
gagaaggcgcccgcggccgggaagaagcccaaggccgagaagcggctgccggcgtccaag
ggggagaagggcggcgagggcaagaaggagcgcggcaggaagaaggccaagaagagcgtc
gagacctacaagatatacatcttcaaggtgctcaagcaggtgcacccggacatcgggatc
tcctccaaggccatgtcaatcatgaactcgttcatcaacgacatcttcgagaagctcgcc
ggcgaggccgccaagctcgccaggtacaacaagaagcccaccatcacctccagggagatc
cagacctccgtccgcctcgtcctccccggcgagctcgccaagcacgccgtctccgagggc
accaaggccgtcaccaagttcaccagctcttag

DBGET integrated database retrieval system