KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346100Help
Entry
4346100           CDS       T01015                                 

Definition
Os08g0527100
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     4346100
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   4346100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 959 aa AA seqDB search
MDEEKASKGRPLNAPCLDLDLNLDLFAAAVPDPGCGDTASPEASKPEEKASKGRPLKAPR
LDLDLNLLAPAVPDPGCGDLALPGASKPGEKAAATTSNTDEELCAHFVRFEEDMVQFISK
LRSSKFAARCEHYLCENKVEKSSILVCIDCSLPFCIGDGTMDKPQGHARWHADLEQHCVA
ALFSKPDTLYCFICERCLNMEVDDTESESDRTECRHLLDEEDVTLIVSEVTTSKNIPACQ
HPGCKINGRTRIMVCTGCNKHFCTRAEAKKKPHGHARLHARKFEHHWVGLWYSDPYKGYC
FKCEFDLTLSAPTVEQGMVFGKELFGQESGLVKGHGCVIRGMPNLGNTCYINALLQCLFV
LGKLRARMLAPDAPSYILGYELKELFQEVNNVDNAQLQLNPTKFFACIRVLDARFISSDM
QDSHELLCFLLNELDKEEKSMVPPVSPTVVDSIFRVQLSATISCSHCSYNSVSHEVMYEL
SVPLPSERPPPKSIASPPRDISCMSREKTGIKLFPEVDTSNTEIVKAIAEGSVSHIASLE
LGDVDKEKTSEPLDGDSVEVEQRSPSKADDLGQNDNAGFENTSGEPQVSIEAKKNACSVE
GASEDKGKAQFSNMAYGKAKDNDSLASIEECLALFFKEELLEWRCDNCSGVSHHLSTTGS
KDGEQIMASTNENTIIDRDQTVQLDKVARQSEQSKNLESLALECTSSKQPHGSDSERKAM
LAMDSITEGINTLPPVKHTYSLRSRGRPPSHNKITSGMIHGEQDLASDNIANKKTDCHER
VQEAVSSCLPAEEPDDLLSGQENTSSLDQGKWKQVKVDHSADQVDAKQKERENRNQGGIQ
TRVINKLPPVLAIHLKRSKETGKVRGHVNFEEILDVGQFMDPSSEDKDNSSYHLVGVIEH
IGPSTSSGHMVAYVRPNQEQPDGGTSPWYRASDTDIRQVSLEEVLKCEASLFFYERIGG
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggagaaggcgagcaaggggaggccgctcaatgccccctgcctggatttggac
ctgaacctggatctgtttgctgcggccgtgcccgatcccggatgcggcgacacggcttcg
ccggaggcgagcaagccggaagagaaggcgagcaaggggaggccgctcaaagccccccgc
ctggacctggacctgaacctgcttgctccggccgtacccgatcccggatgcggcgacctg
gctttgccgggggcgagcaagccgggagagaaggcggcggcgacgaccagcaacaccgat
gaggagttatgtgcccacttcgtacgttttgaggaagacatggtacagttcatatcaaag
ctcaggtcctccaagttcgccgcgaggtgtgagcattacctgtgtgagaacaaggtggaa
aagagcagtatcttggtgtgcatcgattgcagcttgcctttctgcattggggacgggacc
atggacaagccgcagggacacgcccggtggcacgccgatctggagcagcattgtgtcgct
gcattgttcagtaaaccggacactctgtactgcttcatttgtgaacgttgtctgaatatg
gaggtcgatgacacggaatcagaaagcgacagaacggaatgcagacacttattggacgag
gaagacgttactctgattgtgtcagaggtcaccacctccaagaacattccggcgtgccaa
catcccgggtgtaagatcaatgggaggacccgtatcatggtgtgcacgggatgcaacaag
catttctgcactagagctgaggccaagaaaaaaccgcatggacatgcccggctgcatgcg
cggaagtttgaacaccattgggttggtttgtggtacagtgatccatataaggggtactgc
ttcaaatgtgaatttgacttgaccctcagtgcaccgactgttgagcaggggatggtgttt
ggcaaggaattatttggtcaagaatctggattagtgaaggggcatggctgtgttatcaga
gggatgccgaatcttggaaacacttgctacatcaatgcgttgttgcagtgcctatttgtg
cttggcaagctgcgggcaaggatgttagcaccagatgctccttcgtatatccttggttat
gaactgaaagagctctttcaggaggtaaacaacgttgataacgcacaactccaactgaac
cccacgaagttctttgcttgtattcgtgttttggatgcacggttcataagcagtgatatg
caagatagccatgaattgctttgctttttactcaatgaattggataaggaggagaagtca
atggtgcctccagtatctcctacagttgttgattccatttttcgtgttcaactgtctgct
accatttcctgcagccattgctcatataattcagtttcccatgaagtaatgtatgagctc
tcagttccactgccatcagagaggcctccgccaaaaagtattgcatcgccaccaagggac
ataagttgcatgtctcgagagaagactggtatcaaactattcccagaggttgacacgagt
aacaccgaaattgtcaaagcaattgctgaaggcagtgtttctcatatcgctagtttagaa
ctgggagatgtggacaaagagaaaacatctgagcctttggatggtgattctgttgaagtg
gaacagcgctcgccaagtaaggctgatgatttagggcaaaatgacaatgctggttttgag
aatacgtccggtgagccccaagttagtatagaagccaagaaaaatgcttgctctgtagaa
ggtgcttcagaagacaaggggaaagctcagtttagcaatatggcttatggcaaggcaaag
gataacgactctcttgcatcgattgaagagtgcctagcactattttttaaagaagagctg
ctggaatggagatgtgataactgttctggagtttctcaccatctgagcaccactggtagt
aaagatggtgaacagataatggcaagcaccaacgaaaacacaataattgacagagatcag
actgtgcagttggacaaggtagcacgccagagcgagcaatctaaaaatttggaaagtttg
gcactagaatgcacttcaagtaagcaaccacatggttctgattcagaacgtaaagctatg
ctcgcaatggacagcattactgaaggaatcaacacactacctcctgtcaagcacacatac
tcattgcgcagccgaggtcgaccaccaagccataacaaaatcacttctgggatgatccat
ggtgaacaagacttggcctctgataacatagccaacaaaaaaactgattgccatgaacgt
gttcaagaagctgtatctagttgccttccagctgaggaaccggacgacctgttgagtggc
caggaaaataccagcagtctagatcagggtaagtggaaacaagtaaaggtggatcatagt
gcagaccaagtggatgcaaaacaaaaagagcgggaaaataggaatcaaggtgggattcaa
actcgtgttattaacaagctgccacctgtattggccattcatctgaagagatccaaggag
actggtaaagttagaggacacgtgaactttgaggagatccttgatgtaggacagttcatg
gaccccagttctgaggacaaagacaattccagctatcacctagtcggtgtcattgaacac
attggccccagcaccagttcagggcacatggttgcttacgtgagaccaaatcaagagcag
cctgacggtggcacttccccttggtatcgtgcaagtgataccgacatcagacaagtatct
ctagaagaagttctcaagtgcgaggcctctcttttcttctatgagagaattggaggctaa

DBGET integrated database retrieval system