KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346109Help
Entry
4346109           CDS       T01015                                 

Definition
Os08g0528100
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 946 aa AA seqDB search
MAEFSSAKCCMKSRRTPEATWCDFGVMNEEKRARVGDTAETPRKSPRLDRPAAAAAAAAP
LTSNGVMGEKKKKNATRDVSDWCWWGKAAALLSGGDRRTRRCRHVLCEQADIDVAITLIK
TRVDTPVCCVNKCDDTEGREISVCLDCQLSFCTAHGKPHVFMNDHWIALVYKRPNVAHCF
ACEECYFIRTDSLGEGMAVGENGFSIGTHKKDEKGMTTVNNEAGVHASMVSDYESALMVA
LLSDVGTPRCRHDMYNKDEVDLVQRRIMFCDITRMCSDCDNISVLMIFVCLGCEKPFCTV
HSSLHAESTKHLVGLVYHNPYVACCFLCSETFVLIGEGDKRMPVDKAAGGYASESVIGHA
HAIKGIPNLGNTCYLNSLMQCLLVLGKLRARMLGPDAPSGTLGTALHDLFEQTYSVNNAT
GLLETSLLLDCVCNLDPQFVGGFMHDNHELLCCLRKNLDEEERMRTPPNMQDSSAGAVPP
TVFNSIFGGQLFVTRSCKCCSFCSVSHAVFYDLSVPVPPKKPPAKSVESTPWIEGHRSQP
KICINQFEAIHKRNTEKTHRIVEDADSDPASELKDMVMVKTSEPLEVDYTEVEQISQSKD
YVQDPQNVLADVKTAGMDATTTDTRIPEYIGPHPPVSQLREENAQLESCNDVGKDGNAIL
EVSSEHKIDTFSAEVTTEDKGKTCRYRLSSIDYECLELHFKAEMIEWTCENCSKGARKSD
VTEGTYSEQMLSSTNEDTAVGGYQREQSEKITCQSEQSNKKPECPEGVQDAVPHCVPAER
QDNLLSSQDQNATTLDEGRGKQKLHHSAHQVEECQNEQKDRNKGATQTRISKLPLVLTIH
LMRSLLGPDKVMGHVSFKEILDMGLFMDPSSEDKDNSIYRLAGVIEHHGRGKDSGHFVAY
VRPSPRQQTNGSSSWFCASDTDIREVSLEEVLKCEAYLLFYERMEG
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattctcgtcagcgaaatgctgcatgaaatctcggcggacaccagaagcaacc
tggtgtgattttggtgtgatgaacgaggagaagagggcgagggtgggggatactgccgag
accccgcggaaatcccctcgcctggatcggccagctgcggcggcggcggcggcggcgccg
ttaaccagcaacggcgtgatgggcgagaagaagaagaagaatgcgacgcgggatgtgagc
gattggtgttggtgggggaaagcggcggcattactatccggcggcgaccgccgtactcga
cggtgccgccatgtcttgtgtgagcaggctgacattgatgtggccataacactgatcaag
acccgcgttgacaccccggtgtgttgtgttaacaagtgtgatgatactgaggggagggaa
atctcggtgtgtttggattgccagttgagtttctgcacggcacacgggaagccgcacgtc
tttatgaacgaccattggattgctctggtgtacaagaggcccaatgtggcgcattgcttc
gcgtgtgaagagtgctatttcatcagaaccgacagtctcggggagggaatggcggtcggt
gagaatggcttctccatcggtacccataagaaggatgagaagggaatgacgacggtcaac
aatgaggcaggtgttcatgcatctatggtgtctgattatgaaagcgccctcatggtggct
ttactcagtgatgtcggtactccacggtgcaggcatgacatgtataacaaggatgaggtt
gatttggtccaaagacggatcatgttctgcgatatcaccagaatgtgtagtgattgtgac
aacatcagtgtgcttatgatctttgtgtgcttgggatgtgaaaagcctttctgcactgta
cactccagtttacatgctgagagcaccaagcatttggttggtctggtgtaccataacccg
tatgtggcgtgctgcttcctgtgtagtgaaacctttgtcctcattggtgagggggataag
aggatgccagttgacaaagcggcaggtggttatgcatctgagtcagttattgggcatgcc
catgctatcaaagggataccgaatcttggaaacacttgctacttgaattcattgatgcag
tgcctccttgtgcttggaaaactgcgggcaaggatgttaggaccggacgctccatcaggg
acccttggtactgcattgcatgacctctttgagcaaacatacagtgtgaataatgcaaca
ggcctgctggagacgtcattgctcttggattgtgtatgcaatttggacccacagttcgta
ggaggttttatgcatgataaccatgaattgctttgctgtttacgtaaaaatttggatgag
gaggagaggatgaggacgcctcctaacatgcaagacagttctgctggtgcagtgcctcct
acggtttttaattccattttcggtggtcagctatttgttaccagatcgtgcaaatgttgc
tcgttttgttcagtttcccacgctgtattctatgatctctcagtaccagtaccaccgaag
aagcctccagccaaaagtgttgaatcaacaccatggattgaaggtcacagatctcaaccg
aagatttgtatcaaccagtttgaagcaatacataagaggaacacagaaaagactcataga
attgttgaagatgccgattctgatcctgcttcagaattgaaagatatggtcatggtgaaa
acatcagagccattggaagttgattatactgaagtggaacagatctcacaaagcaaggac
tatgtacaagatcctcaaaatgtgttggctgatgtcaaaactgcaggaatggatgcgaca
acaacagatacccgcattccagaatatatagggccacatccacctgtctctcaattaagg
gaagagaatgcacagttagaatcatgcaatgatgtggggaaagatggcaatgctattctc
gaagttagttcagaacacaagatagacactttctcagcagaagttactacagaagacaag
gggaaaacttgcagatatcgactctcttccatcgattacgagtgcttggaactgcacttt
aaagcagagatgatagaatggacctgtgagaactgctccaaaggtgctcggaagtcagat
gtcactgaaggtacatacagtgaacagatgctgtcaagtactaatgaggacacagcagtt
ggtggataccagagggaacagtcagagaagataacatgccaaagtgagcaatccaacaaa
aaacctgaatgccctgaaggtgttcaagacgctgtacctcattgtgtcccagctgagaga
caggacaacctgttgagcagtcaggatcaaaatgccaccacactagatgaaggaaggggt
aagcaaaagcttcatcatagtgcacaccaagtcgaagaatgccaaaatgagcagaaagat
aggaataaaggtgctactcaaacacggattagcaagttgccacttgtgttaaccattcat
ctgatgagatctttgttggggcctgataaggtgatgggacatgtgagctttaaggaaatc
cttgatatgggactgttcatggaccccagctctgaagacaaagataattccatttatcgt
ctagctggtgttattgagcaccatggccgcggcaaagattcagggcactttgttgcttat
gtgagaccaagtcctcggcagcagaccaatggttcttcctcatggttttgtgcaagtgat
accgacatcagagaagtctctttagaagaagttctcaagtgcgaggcttaccttcttttc
tacgagaggatggaaggctga

DBGET integrated database retrieval system