KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346293Help
Entry
4346293           CDS       T01015                                 

Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase 1 isoform X1
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     4346293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 PrmA Methyltransf_25 MTS Methyltransf_23 Methyltransf_32 Methyltransf_11 EF-hand_5 GCD14 FtsJ CMAS Fibrillarin
Motif
Other DBs
NCBI-GeneID: 4346293
NCBI-ProteinID: XP_015650447
Position
8
AA seq 254 aa AA seqDB search
MEVLRYIFSCFSSSSSKSSSASAGSHRLWSSGASDKNKAMVEQLQRYGIIKSSKVAQVME
TIDRGLFVPPGASPYFDSPMPIGYNATISAPHMHASCLELLEKHLQPGMRALDVGSGTGY
LTACFAIMVGPEGRAVGVEHIPELVTSSIENIKKSAAAPQLTDGSLSIHITDGREGWPEL
APYDAIHVGAAAPQIPQALIEQLKPGGRMVIPVGTMFQELKVVDKNQDGKVSIRDETAVR
YVPLTSKDAQLQAN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaggtactccgctacatcttttcctgcttctcctcctcctcctccaaatcatcctca
gcatctgcgggctcccaccgactgtggtcaagcggggctagcgacaagaacaaggcaatg
gttgagcagctccagaggtacgggattatcaagtcgagcaaggtcgcgcaggtgatggag
accatcgacagggggctgtttgtgcctcctggtgcttctccctatttcgacagcccgatg
cccatcggttacaacgccaccatttctgcgcctcacatgcacgcctcttgcttggagctc
ctggagaagcaccttcagcctggcatgcgtgctctggatgttggatcaggcacagggtac
ctaacagcttgcttcgcgattatggttggaccagaagggcgagcagttggtgttgaacat
atcccagagttggttacttcgtctattgaaaacatcaagaaaagtgcagcggctccacag
ttaactgatggatccctcagtatacatattaccgatggcagagaaggttggccagagctc
gcaccctatgatgccatccatgtcggagctgctgcaccgcagattccacaggcgttgatt
gagcagctaaagcccggtggcagaatggtgatcccagttgggactatgttccaggagctg
aaagtggtggacaagaaccaggatggcaaggtcagcataagagatgagacggctgtgcgc
tatgtgcccctcacaagcaaggatgcgcagctgcaggctaactga

DBGET integrated database retrieval system