KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346293Help
Entry
4346293           CDS       T01015                                 

Gene name
OJ1150_A11.18, PIMT1
Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase 1
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     4346293 (OJ1150_A11.18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 254 aa AA seqDB search
MEVLRYIFSCFSSSSSKSSSASAGSHRLWSSGASDKNKAMVEQLQRYGIIKSSKVAQVME
TIDRGLFVPPGASPYFDSPMPIGYNATISAPHMHASCLELLEKHLQPGMRALDVGSGTGY
LTACFAIMVGPEGRAVGVEHIPELVTSSIENIKKSAAAPQLTDGSLSIHITDGREGWPEL
APYDAIHVGAAAPQIPQALIEQLKPGGRMVIPVGTMFQELKVVDKNQDGKVSIRDETAVR
YVPLTSKDAQLQAN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaggtactccgctacatcttttcctgcttctcctcctcctcctccaaatcatcctca
gcatctgcgggctcccaccgactgtggtcaagcggggctagcgacaagaacaaggcaatg
gttgagcagctccagaggtacgggattatcaagtcgagcaaggtcgcgcaggtgatggag
accatcgacagggggctgtttgtgcctcctggtgcttctccctatttcgacagcccgatg
cccatcggttacaacgccaccatttctgcgcctcacatgcacgcctcttgcttggagctc
ctggagaagcaccttcagcctggcatgcgtgctctggatgttggatcaggcacagggtac
ctaacagcttgcttcgcgattatggttggaccagaagggcgagcagttggtgttgaacat
atcccagagttggttacttcgtctattgaaaacatcaagaaaagtgcagcggctccacag
ttaactgatggatccctcagtatacatattaccgatggcagagaaggttggccagagctc
gcaccctatgatgccatccatgtcggagctgctgcaccgcagattccacaggcgttgatt
gagcagctaaagcccggtggcagaatggtgatcccagttgggactatgttccaggagctg
aaagtggtggacaagaaccaggatggcaaggtcagcataagagatgagacggctgtgcgc
tatgtgcccctcacaagcaaggatgcgcagctgcaggctaactga

DBGET integrated database retrieval system