KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346352Help
Entry
4346352           CDS       T01015                                 

Definition
Os08g0565700
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    4346352
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     4346352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 594 aa AA seqDB search
MASPPPPPRLLTPKPDPDAPLPPLPYPDPNLVQSMLFSAQSPQAQPQAPPPHIQPPASAS
AEAPSGDEKNKKKKKRARASQEMVRITNLSIADHLHYRSLVRRARLTFEALRAIYQRQDL
ATAGGIRNRFDLRASSKMLSKGLWMHRDIRTVGSIPGLLVGDSFFYRAELCVLGLHTAPQ
AGIGYIPASIVDQGHPVATSIVSSGGYLDDEDSGDVLVYSGSGGRLRNRLDHSADQTLQR
GNLALHYSCHYGIEVRVIRGHACDHSPSSKVYVYDGLYRVVTSTFGPGKSGRDVCKFKLV
RIPGQDDLGSKAWHTAAELKDALDSKIRPPKYISLDIAKGKEPFRVPLYNKLDDDRSPLF
YDYIACPDFPTTQQLLKRQTQRGCHCAELCGSRCSCERKNRGADGPVYTSDGILLRGRPL
VYECGPLCGCPMTCPNRVTQQGMKHRLEVFRSKETGWGVRTLDLIQPGAFICEYAGDVLS
LDSHSGDAPLPPMEDGSSIIDPTKFPERWREWGDASVVYPDRVPHFPLFAGARYRLDVSQ
RRNVACYISHSCSPNVFLQYVIRGNEDESYPHMMVFAMETIPPMRDLSIDYGLD
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctccgccgccgccgcctcgcctcctcactcccaagcccgaccccgacgccccc
ctacccccgctcccttaccccgaccccaacctcgtccaaagcatgctcttctccgcccag
tccccgcaggcgcagccgcaggcgccgccaccccacatccaaccccccgcctccgcctcc
gccgaggccccctccggcgacgagaagaataagaagaagaagaagcgggcccgcgcctcc
caggagatggtgcgcatcaccaaccttagcatcgccgaccacctccactaccgctccctc
gtccgccgcgcccgcctcaccttcgaggccctccgcgccatctaccaacgccaggacctc
gccaccgccgggggaatccgcaaccgcttcgacctccgggcctccagcaagatgctctcc
aagggcctctggatgcaccgcgacatccgcaccgtcggctccatccccggcctcctcgtc
ggggactccttcttctaccgcgccgagctctgcgtcctcggcctccacaccgcccctcag
gccggcatcggctacatccccgccagcatcgtcgaccagggccaccccgtcgccaccagc
atcgtctcctccgggggatacctcgacgacgaggacagcggcgacgtcctcgtctactcc
ggcagcggcggccgcctgcgcaaccgcctcgaccacagcgccgaccagacgctccagcgc
ggcaacctcgcgctccactacagctgccactacggcatcgaggtgcgcgtcatccgtggc
cacgcctgcgaccacagccccagcagcaaggtctacgtctacgacggcctctacagggtt
gtcacctccaccttcggccctggcaaatccggccgcgacgtctgcaagttcaagctcgtg
cgcatccctggccaggacgacctcggcagcaaggcctggcataccgcagcggagctcaag
gatgcactggattccaagatccgcccgcccaagtacatctcgctcgacattgccaagggc
aaggaaccattccgcgtgcccctctataacaagctcgacgacgacaggtcacccctcttc
tacgactacattgcctgtcccgacttccccaccacccagcagctgctcaaacgccagacc
cagaggggctgccactgtgccgagctgtgcggctccaggtgcagctgtgagaggaagaac
aggggggccgacggccctgtgtacacctccgatggcatccttctcaggggacgccccttg
gtgtacgagtgcggacccctgtgtggatgccccatgacctgtcccaacagagtcacacag
caagggatgaagcaccgcctcgaggtgttccgttccaaggagacaggctggggtgtcagg
acgcttgacttgatacagccgggtgccttcatatgcgagtacgccggcgacgtgctctcc
ttggacagccactcaggtgacgcccctctgcctccgatggaggacgggagctccatcatc
gacccgaccaagttccccgagagatggagggagtggggagatgcatccgtggtttacccg
gacagggtaccccatttccccctatttgcaggggcgcgctaccgactcgacgtgtcacag
aggaggaacgtggcttgctacattagccacagctgcagtccgaatgtgttccttcaatat
gtaatccgtggcaatgaggatgaatcctaccctcacatgatggtgtttgccatggagacc
atccctccaatgcgggatctgtccatcgactatggcttggactag

DBGET integrated database retrieval system