KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346527Help
Entry
4346527           CDS       T01015                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: beta-fructofuranosidase, insoluble isoenzyme 7-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    4346527
   00500 Starch and sucrose metabolism
    4346527
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4346527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
9
AA seq 643 aa AA seqDB search
MLFSQTHDSGHQPNRRFLQSFRAEAETPTRRRSARSSSPSPPAAAMARLGLAVCAASFHL
FLLLASTSSLRRAPTEADTANHARRTAYHFQPAKNWQNDPNGPMYHNGMYHLFYQYNPHS
ALWDIGNLSWGHSVSGDLLNWAALDTALDPTSPFDANGCWSGSATILPGALPAILYTGID
ASKEQVQNVAFAKNPSDPLLREWEKPAYNPVIALPADVPGDKFRDPSTAWLGRDGLWRIA
VSAEVDGVASTLVYRSKDFVRWERNAAPLHASRAAGMVECPDLFPVAERGEDGLDTSANG
AGGVRHVLKLSVMDTLQDYYMVGTYDDAADAFSPAEPERGDDCRSWRRLDYGHVYASKSF
FDVRKNRRVLWAWANESDSQADDVARGWSGVQTFPRKMWLAKDGKQLLQWPIEEIKTLRR
KRAGLWQGTRLGAGAVQEIVGVASSQADVEVVFKIPSLEEAERVDDPNRLLDPQKLCGEK
GAAVRGGVGPFGLLVMASGDLHEHTAVFFRVFRHHDKYKLLMCTDLTKSSTRAGVYKPAY
GGFVDMDIDDHKTISLRTLIDHSVVESFGGGGRACITARVYPEHVATSSSHLYVFNNGSD
AVKVAKLEAWDLATATVNVVVGDHHGLVAPALELEPXTHDAVI
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcttttttctcagactcatgactcagggcaccaaccaaacaggcgttttcttcagagt
ttcagagcagaagcagagacaccaacaagaaggcgatcagctcgttcttcttctccctct
cctccagcggcggccatggcgagattaggccttgccgtctgcgccgcctccttccacctc
ttccttcttcttgcgtcgacctcctcgctccggcgagctcccacggaggcggacacggcc
aaccatgccagaagaactgcctatcacttccagcctgcaaagaactggcagaatgatccg
aatgggcctatgtaccataacggtatgtaccatttgttctaccagtacaacccgcatagc
gcgctctgggacatcggcaacctctcctggggccactccgtctccggcgacctcctcaac
tgggccgctctcgacaccgcgctcgaccccacctcgcctttcgacgccaatggctgctgg
tcgggctccgccaccatcctccccggcgccctcccggccatcctctacaccggcatcgac
gccagcaaggagcaggtccagaacgtcgccttcgccaagaacccctccgatccgctcctc
cgcgagtgggagaagcccgcgtacaatccggtcatcgcgctcccggccgatgtccccggc
gacaagttccgtgacccctcgacggcatggctcggccgtgacggcctgtggcggatcgcc
gtctccgccgaggtggacggcgtcgcgtccacgctcgtctacaggagcaaggacttcgtc
cggtgggagcggaacgccgcgccgctgcacgcgtcgcgcgccgcgggcatggtggagtgc
ccggacctgttccccgtagcggagcgcggcgaggatggcctcgacacgtcggcgaacggc
gccggcggcgtgcgccacgtcctgaagctgagcgtgatggacacgctccaggactactac
atggtcggcacgtacgacgacgcggcagacgccttctcgccggcggagcctgagcgcggc
gacgactgccggagctggcggcggctggactacgggcacgtgtacgcgtccaagtcgttc
ttcgacgtgcgcaagaaccggcgcgttctgtgggcgtgggcgaacgagtccgacagccag
gccgacgacgtcgcccgcggctggtccggcgtgcagacattcccgaggaagatgtggcta
gccaaggacggcaagcagctgctgcagtggccgatcgaggagatcaagacgctgaggagg
aagcgcgccggtctctggcaaggcaccaggctaggcgccggcgcggtgcaggagatcgtc
ggcgtggcgagctcgcaggcggacgtggaggtggtgttcaagattccgagcctggaggag
gccgagagggtggacgaccccaaccggctgctggatccccagaagctgtgcggtgagaag
ggcgccgccgtgcggggcggcgtcggcccgttcgggctcctcgtaatggcctccggcgac
ctgcacgagcacaccgccgtcttcttcagggtgttcaggcaccatgacaagtacaagctt
cttatgtgcaccgacttgacaaagtcgtcgacaagagcaggggtgtacaagccggcttac
ggcggattcgtggacatggacatcgacgatcacaaaaccatatcgctgagaacgttgatt
gaccattcggtggtggagagcttcggcggcggcgggcgggcgtgcatcacggcgcgggtt
tacccggagcacgtggcgacgagcagcagccatttgtacgtgttcaacaacgggagcgac
gccgttaaggtggccaagctggaggcgtgggacctggcgacggcgaccgtcaacgttgtt
gttggagaccaccacggccttgttgcgccggcgttggagttggagccgnacacgcacgac
gcagtgatctga

DBGET integrated database retrieval system