KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346529Help
Entry
4346529           CDS       T01015                                 

Definition
Os09g0255400
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    4346529
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4346529
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     4346529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 381 aa AA seqDB search
MESLLAASSSLPAAAFSPPSSLSSTSSSPHALRSAVAGAARAVRCSAAKDSILYALEHDE
MFNSAEVIQWESGKSINSIAAAQGIRIRRRCRPRYPSEGSGADKAVPRNMLEQIIWDKEV
EVSQRKAKKPLQKVIESSQHAPPARDFVGALTAAYSRNVAPALIAEVKKASPSRGVLRED
FNPVEIAQSYEKNGAACLSILTDEKHFQGSFENLETVRNSGVKCPLLCKEFVIDIWQIYY
ARSKGADAILLIAAVLPDLDIKYMLRICKNLGMTALIEVHDERELDRVLKIDGVQLIGIN
NRSLETFKVDTSNTKTLLEKRGDLIRDKGILVVGESGLFTPDDVAYVQNAGVSAILVGES
LVKQENPGQAIAGLYGKDLLH
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggagtccctcctcgccgcctcttcctctctccccgcggccgccttctcgccgccgtcg
tccctctcttcgacctcctcgtcgccgcacgccctacggtcggccgtcgccggagccgcc
cgcgcggtgcgctgctccgccgccaaggattcgatcctgtacgcgctggagcacgacgag
atgtttaactcggcggaggtgatccagtgggagagcggcaagtccatcaactccatcgcc
gccgcgcagggcatccgcatccgccgccgctgccgcccacgctacccctccgagggctcc
ggcgccgacaaagccgtcccccgcaacatgctcgagcagatcatctgggacaaagaggtc
gaggtgtcccagaggaaggcgaagaagccgctgcagaaggtgatcgagtcgagccagcac
gcgccaccggccagggacttcgtcggcgcgctaacggcggcctacagccgcaacgtcgcg
ccggcgctgatcgccgaggtgaagaaggcgtcgccgagcagaggcgtgctccgggaggac
ttcaatccggttgagatcgcgcaatcctatgagaagaacggcgcggcttgcctcagtatc
ctgaccgacgaaaaacactttcagggtagctttgagaatctcgagaccgttcgcaattcc
ggagtaaagtgccctcttctttgcaaggagtttgtgatagatatctggcaaatctattac
gctcggtcaaagggtgcggatgcaattctgttgattgctgccgtgttacctgatctcgac
atcaagtacatgcttcgcatctgcaagaacctcggaatgacagctctcatagaggttcat
gatgagagggagctggatcgtgtgctcaaaatagatggcgttcagcttatcggcatcaat
aaccgaagtttagagacgtttaaggttgatacttcaaacacaaagaccctgttggagaaa
cgtggtgacctcataagggataaagggattctggttgttggtgaatctggtcttttcacg
cctgatgatgttgcatacgtgcagaatgctggtgtttctgcaattttggtaggagagtcc
ctggtgaaacaggaaaatcccgggcaagccattgctggactatatggaaaggatcttttg
cactga

DBGET integrated database retrieval system