KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346677Help
Entry
4346677           CDS       T01015                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    4346677
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     4346677
Chromosome [BR:osa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     4346677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
9
AA seq 394 aa AA seqDB search
MIGRYGHPPNPLLLLRPHLASFLRRLPPLRHCSLAYGLELVADPRHRRDLCLPPMPRPAK
IRKKHENVFDQLIKAIKAPVDFDLPPVLKEWKSNYYVPIKRNAYITRKRVEDDGIFCSCT
PSGSSATCDKDCQCGMLFSCCSSTCKCENKCANKPFQHRTLRKTKLIKTEKCGNGVVAEE
DIKKGEFVIEYVGEVIDDRTCEQRLWKMKRQGDTNFYLCEVSSNMVIDATNKGNMSRFIN
HSCEPNTEMQKWTVEGETRVGIFALRDIKTGEELTYDYKFVQFGADQDCHCGSSNCRKML
GITKPVNSIVLHNGNLSQDQHVRKKRKTYLENCIGEIVRLWHRRHSMYLAASIYDFNERN
GIHTLLFTDATIEEFDLREEDWDFLPDPDGPEEV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgataggtaggtacggacatcccccaaatcctcttcttctgctccgacctcacctcgcc
tccttcctccgccgactccctcccctccgccattgcagcctcgcctacggccttgagctc
gtcgccgatccccgccaccgccgcgacctctgcctgccccccatgcctcggccggcgaaa
atcaggaaaaaacatgagaatgtgtttgatcaattgatcaaggcgataaaagctcctgtg
gactttgatctgccgcctgtattgaaagaatggaagtcaaattactatgtgccaattaag
cggaatgcttatattactcggaaacgcgttgaggatgatggcattttttgttcctgtacc
ccttctggatcatccgcaacttgtgacaaagattgccaatgcgggatgttgttctcttgt
tgttcgtcgacctgtaaatgtgagaataaatgtgctaacaaaccgttccagcataggact
ttgaggaaaaccaaattaattaagacagagaaatgtggcaatggggtggtagctgaggaa
gatattaaaaaaggagaatttgtaatcgaatatgttggagaagttattgatgacagaaca
tgtgagcagagactatggaaaatgaagaggcagggtgacactaatttctatctttgtgag
gtcagtagtaatatggtgatcgacgcgaccaacaaaggaaacatgtcgcgcttcataaat
catagctgtgagccaaacacagagatgcagaaatggactgttgagggagagaccagagtt
ggaatttttgctcttcgtgacataaaaacgggggaggagctgacctatgattacaagttt
gtccaatttggagctgatcaagattgtcactgtggatcttcaaactgtcgaaaaatgctt
ggcatcacaaagcctgttaactcaattgtacttcataatggaaatctgtcacaagatcag
catgtccggaagaaaagaaagacatatttggagaattgtattggggagattgtccgtttg
tggcatcgacgtcacagcatgtatctcgcagcaagtatatatgacttcaatgagcgcaat
ggaatacatacattattgtttaccgatgcaactattgaagaatttgatttgagagaggaa
gattgggacttcttaccggatccagatggtcctgaggaagtgtga

DBGET integrated database retrieval system