KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346812Help
Entry
4346812           CDS       T01015                                 

Definition
Os09g0347800
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     4346812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 466 aa AA seqDB search
MALKQKGTDAAADPKKRRRVGFSGIDAGVEANECMKVFIARNPDEAGSANSTSLQPFDLN
HFFGEDGKIYGYKNLKINVWISAISFHAYADISFEETSDGGKGITDLKPVLQNIFGENLV
EKDEFLKTFSKECEYLSNVVTDGNVIKHDASIDEDSAVEIVRVELQGAAAFLYCRLVPLI
LLLVEGSTPIDITEHGWEMLLVVKKSAQASSSSNFLVLGFAAVHHFYHYPESTRLRISQI
LVLPPYQGEGHGLRLLETINSISESENIYDVTIEDPSDYLQYIRSSIDCLRLLTFDPIKP
ALCSMVSSLKDTNLSKRTSSLKMVPPSDLAETVRQKLKINKKQFLRCWEILIYLNLDAED
RKSMDNFRACIYDRIKGEILGTSTGPNGKRLVQMPSNFDEETCFAVYWTQDGGDADDQTV
EQQPEDLKTQEQQLNEVVDSQMEEIVEIAKNVTSRGKDKLSVSCSV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaagcagaaggggaccgacgccgccgccgaccccaagaagcgccgccgcgtc
ggcttctccggcatcgatgctggcgttgaggctaacgagtgcatgaaagtgtttattgca
agaaaccctgacgaggcaggctcagcaaatagcacttctcttcaaccatttgacctaaat
catttttttggtgaagatggcaagatatatggctacaaaaatttgaagatcaatgtgtgg
atcagtgcaatatcatttcatgcatatgctgatatctcatttgaggaaacatctgatgga
ggaaaaggaatcacagatctcaagcctgttcttcagaatatttttggggaaaacttggta
gaaaaagatgaatttctgaagacattttcaaaggaatgtgaatatctcagcaatgtggtg
acagatggcaatgtcattaaacatgatgcttcaattgatgaagattcagcagttgagatt
gttcgagttgaactacaaggtgctgctgcttttctttattgtcgtctggtgccacttatt
ctgcttttggttgaaggttcgacgcctatagatataactgagcatggatgggaaatgctc
ctggtagtaaagaagtcagcacaggcgtcatccagctctaactttctagtgctagggttt
gcagctgttcatcatttttatcactaccctgagagcactcgcctgcggatcagccagata
ctggtcttgccaccttatcaaggtgaaggccatggacttcgtcttcttgagacgatcaat
tctatttctgagtctgagaacatatacgatgtgaccatagaagatccttccgattacctt
cagtacatacgttcatccattgactgtctccgccttctcaccttcgatccaatcaagcca
gcgctctgttccatggtctcatctctgaaggataccaacctttcgaaaaggaccagcagc
ttgaaaatggttccaccttccgaccttgctgagacggtccgacagaagctgaagatcaac
aagaagcagttcctccggtgctgggagattctgatctacctaaaccttgacgctgaggac
cgcaagagcatggacaacttcagggcctgcatctacgaccgcatcaaaggcgagatactt
ggcacttccactggccccaacgggaagcggctcgtccaaatgccgagcaatttcgacgag
gagacatgctttgctgtgtactggacacaggacggtggggatgcagatgaccaaactgtt
gagcagcagcctgaggatctcaagacccaggagcagcagctgaatgaggtggttgacagc
caaatggaagagatcgtcgagatagccaagaacgtcacctcacgcggcaaggataaactg
agcgtttcttgctccgtatga

DBGET integrated database retrieval system