KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346967Help
Entry
4346967           CDS       T01015                                 

Definition
Os09g0394100
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:osa00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:osa00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:osa04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 514 aa AA seqDB search
MTRNHSPKSLAVLLRARMHPDPVSPAPPPPAPTAAAAPDPDPSAPPAAAAVRHWLHASVS
SSASTALDRFSDGYRSLDRPGRREILRSLAADYDVPRARVRDLMRQYLSAAAAGGEEEEE
EHPEAGGGGGSASAMYRMERGLREALRPKYAGFLEAMNAQPGGLKLLAVIRADLLALLGE
ENLPALRALDGYLKEKLVTWLSPAALTLHQITWDDPASLLEKIVAYEAVHPIRNLIDLKR
RLGVGRRCFGYFHPAIPGEPLIFIEVALLKDTAASIQEVLWDDPPTPESEARCALFYSIS
STQPGLSGINLGKFLLKRVIEMLRRDMPSVQIFATLSPIPGFMQWLLAKLASQIKLAEAE
SQDGSLLEGTSSTFRESILFPEEERMIHDAVEHAGGKSGIKLLQDILKSSQWVKSDKLSS
ALKSPLMRLCARYLAREKKRGKALDAVANFHLQNGAMIERINWMADQSEKGIQQSGGIMV
NYMYRLENIEEYALSYLGTGLAHTSSNLLQYIEV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaaccactcccccaagtccctcgccgtcctcctccgcgcccggatgcacccc
gaccccgtctcccccgccccgccgccgcccgctccgacggcggcggcggcacccgacccc
gatccgtccgccccgcccgccgccgccgccgtccgccactggctccacgcctccgtctcc
tcctccgcctccaccgccctcgaccgcttctccgacggctaccgctccctcgaccgcccc
ggccgccgcgagatcctccgctccctcgcggccgactacgacgtgccccgcgcgcgcgtc
cgcgacctcatgcggcagtatctgagcgccgcggcggcgggcggggaggaggaggaagag
gagcacccggaggcgggaggcggcggcggctctgcgtcggcgatgtaccggatggagcgg
gggctccgggaggcgctccggcccaagtacgccgggttcctcgaggccatgaacgcgcag
cccggcgggctcaagctcctcgccgtcatccgcgccgacctcctcgcattgctgggggag
gagaacttgccagcgctgcgtgcgctggacgggtacctgaaggagaagctcgtgacatgg
ctcagccccgcggcgctgaccctccaccagataacttgggatgatccggcctccttgcta
gagaagattgtggcatatgaagctgtgcatccaattaggaatttgattgacttgaagaga
aggttgggcgtcggtcgccgttgctttgggtacttccatcctgcaataccaggagaacca
ttgatcttcattgaagttgctctgctcaaagatactgccgcatctatacaggaagttctg
tgggatgaccctccaactcctgagagtgaagccagatgtgcattattttactcaatatca
tcaacccagccaggcctatctggtatcaatctgggaaaatttcttctcaaacgtgtgatt
gaaatgttaagaagagatatgccttcagtacagatttttgcaactcttagtccaatccct
ggtttcatgcaatggcttcttgctaagctggcatcccaaataaagttagcagaggcagaa
tcacaggatggcagtttattagaaggaaccagttccactttcagagaatccatccttttt
ccggaggaagagaggatgatacatgatgcggttgaacatgctggtggaaaaagtggaatc
aaactactgcaagatatactgaaatcaagtcagtgggtaaaatctgacaaattatcttct
gcactgaaatctcctttgatgcgtttgtgtgcaaggtatctcgccagggagaaaaaacga
ggaaaagctcttgatgctgttgcaaattttcacttgcaaaatggagcaatgatcgagagg
ataaactggatggctgaccaatcagagaagggcattcaacagagtggaggtatcatggta
aattatatgtacagattagagaatatagaagagtatgcgctgtcatatttgggtacaggg
ctcgctcatacttcatctaacttgctccaatatatcgaggtatga

DBGET integrated database retrieval system