KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347226Help
Entry
4347226           CDS       T01015                                 

Definition
Os09g0451500
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4347226
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4347226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 441 aa AA seqDB search
MRPAVAAALLLVAAAVAASPVSALYSAGSPVLQFNPNNFKSKVLNSNGVVLVEFFAPWCG
HCQQLTPIWEKAAGVLKGVATVAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGA
RDVKPIVEFALSQVKALLRDRLNGKTSAGSGGKKSGGSSEKTEPSASIELNSQNFDKLVT
KSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVDCDAEKSLMSKYKVEGFPT
ILVFGADKESPFPYQGARVASAIESFALEQLEANAAPPEVSELTGPDAMEEKCASAAICF
VSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAAGKQADLEKQVGVGGYGYPA
MVALNVKKGAYAPLRSAFQLDEITEFVKEAGRGGKGNLPLDGTPTIVQSEPWDGKDGEVI
EEDEFSLEELMADNSPVNDEL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccgcggtcgccgccgccctcctcctcgtcgccgccgccgtcgcggcctcgccg
gtttccgccctctactccgccggctctcccgtcctccagttcaaccccaacaacttcaaa
tccaaggtgctgaactcgaatggggtggtgctggtggagttcttcgcgccgtggtgcggg
cactgccagcagctgacgccgatttgggagaaggccgcgggcgtcctcaagggcgtcgcc
acggtcgccgcgctcgacgccgacgcgcacaaggagctcgcgcaggaatatggaataaga
ggatttccaactattaaggtgtttgttcctggaaagcctccagtagattatcaaggagca
agagatgtaaagccaattgttgaatttgctctttcacaggtcaaggctcttcttagagat
cggttgaatggaaagacatcagcaggttcaggtggcaagaaatcaggtggttcaagtgag
aaaactgaaccaagtgcgtcaatagaattaaattctcaaaacttcgataaacttgtcacc
aaaagcaaggatctttggattgttgagttctttgcaccatggtgtgggcactgcaagaaa
ttggcacctgaatggaaaaaggctgcaaagaacttgaagggccaagtgaagctaggtcat
gtggattgtgatgctgaaaagtctttgatgagcaagtacaaggtagaaggctttcctact
attttggtatttggtgccgataaggagagcccattcccttaccagggggctagagttgcc
tctgctatcgagtcctttgcattggagcagttggaagccaatgctgctccacctgaagtt
tctgagttgactggcccagacgccatggaagagaaatgtgcttctgctgccatttgcttt
gtatctttccttccagatatcttggattcaaaggccgaaggaagaaacaagtaccttgag
ctgctattatctgttgctgagaaatttaaaaagagtccatacagttttgtctggacagct
gctgggaagcaagctgatcttgagaagcaagttggagttggtggttatggctatccagcg
atggttgctctcaacgtgaaaaaaggcgcatatgctccactccgtagtgctttccagctt
gatgaaataactgagtttgtgaaggaagcagggcgcggtgggaagggtaatcttcctttg
gacggtaccccaacgatagtccaatctgaaccatgggacggcaaagatggtgaggttatt
gaagaggacgaattctcccttgaggagctgatggccgacaactctccagtaaatgacgag
ttgtga

DBGET integrated database retrieval system