KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347226Help
Entry
4347226           CDS       T01015                                 

Definition
(RefSeq) protein disulfide isomerase-like 2-3
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4347226
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4347226
Chaperones and folding catalysts [BR:osa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   4347226
Membrane trafficking [BR:osa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    4347226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 OST3_OST6 Thioredoxin_3 Thioredoxin_9 Thioredoxin_7 AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 4347226
NCBI-ProteinID: XP_015611801
UniProt: Q67UF5
Position
9
AA seq 441 aa AA seqDB search
MRPAVAAALLLVAAAVAASPVSALYSAGSPVLQFNPNNFKSKVLNSNGVVLVEFFAPWCG
HCQQLTPIWEKAAGVLKGVATVAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGA
RDVKPIVEFALSQVKALLRDRLNGKTSAGSGGKKSGGSSEKTEPSASIELNSQNFDKLVT
KSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVDCDAEKSLMSKYKVEGFPT
ILVFGADKESPFPYQGARVASAIESFALEQLEANAAPPEVSELTGPDAMEEKCASAAICF
VSFLPDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAAGKQADLEKQVGVGGYGYPA
MVALNVKKGAYAPLRSAFQLDEITEFVKEAGRGGKGNLPLDGTPTIVQSEPWDGKDGEVI
EEDEFSLEELMADNSPVNDEL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccgcggtcgccgccgccctcctcctcgtcgccgccgccgtcgcggcctcgccg
gtttccgccctctactccgccggctctcccgtcctccagttcaaccccaacaacttcaaa
tccaaggtgctgaactcgaatggggtggtgctggtggagttcttcgcgccgtggtgcggg
cactgccagcagctgacgccgatttgggagaaggccgcgggcgtcctcaagggcgtcgcc
acggtcgccgcgctcgacgccgacgcgcacaaggagctcgcgcaggaatatggaataaga
ggatttccaactattaaggtgtttgttcctggaaagcctccagtagattatcaaggagca
agagatgtaaagccaattgttgaatttgctctttcacaggtcaaggctcttcttagagat
cggttgaatggaaagacatcagcaggttcaggtggcaagaaatcaggtggttcaagtgag
aaaactgaaccaagtgcgtcaatagaattaaattctcaaaacttcgataaacttgtcacc
aaaagcaaggatctttggattgttgagttctttgcaccatggtgtgggcactgcaagaaa
ttggcacctgaatggaaaaaggctgcaaagaacttgaagggccaagtgaagctaggtcat
gtggattgtgatgctgaaaagtctttgatgagcaagtacaaggtagaaggctttcctact
attttggtatttggtgccgataaggagagcccattcccttaccagggggctagagttgcc
tctgctatcgagtcctttgcattggagcagttggaagccaatgctgctccacctgaagtt
tctgagttgactggcccagacgccatggaagagaaatgtgcttctgctgccatttgcttt
gtatctttccttccagatatcttggattcaaaggccgaaggaagaaacaagtaccttgag
ctgctattatctgttgctgagaaatttaaaaagagtccatacagttttgtctggacagct
gctgggaagcaagctgatcttgagaagcaagttggagttggtggttatggctatccagcg
atggttgctctcaacgtgaaaaaaggcgcatatgctccactccgtagtgctttccagctt
gatgaaataactgagtttgtgaaggaagcagggcgcggtgggaagggtaatcttcctttg
gacggtaccccaacgatagtccaatctgaaccatgggacggcaaagatggtgaggttatt
gaagaggacgaattctcccttgaggagctgatggccgacaactctccagtaaatgacgag
ttgtga

DBGET integrated database retrieval system