KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347604Help
Entry
4347604           CDS       T01015                                 

Gene name
P0669G04.6
Definition
(RefSeq) uncharacterized LOC4347604
  KO
K03505  
DNA polymerase delta subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4347604 (P0669G04.6)
   00240 Pyrimidine metabolism
    4347604 (P0669G04.6)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    4347604 (P0669G04.6)
   03410 Base excision repair
    4347604 (P0669G04.6)
   03420 Nucleotide excision repair
    4347604 (P0669G04.6)
   03430 Mismatch repair
    4347604 (P0669G04.6)
   03440 Homologous recombination
    4347604 (P0669G04.6)
DNA replication proteins [BR:osa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4347604 (P0669G04.6)
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4347604 (P0669G04.6)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     4347604 (P0669G04.6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 131 aa AA seqDB search
MASGGMKDFYRQKKKGGPTKASSSSKKKTQHYTGGASVGASDTAQTSALISHGNLDLKDD
FSEQEEQLRLFDMDMKFGPCIGVTRLQRWERASAMGLHPPPHLRDLLLNNTHAGNHNNNG
PSLECLWEGKV
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggtggcatgaaggacttttaccggcagaagaagaaaggaggtcccaccaaa
gcatcgtcatcttccaagaagaaaacacagcattacactggaggggcctctgttggggcc
tcagacactgctcagacatcagcactaatttctcatggtaacctagatcttaaagatgat
ttcagtgagcaagaggagcagttgcgactgtttgatatggacatgaagtttggcccttgc
attggcgttactcgtcttcagcgttgggaacgtgcttctgccatgggtcttcacccacca
cctcatctcagggatctcttactgaacaatactcatgcaggcaatcacaataacaatggt
ccctcccttgagtgcctctgggagggcaaagtctag

DBGET integrated database retrieval system