KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347660Help
Entry
4347660           CDS       T01015                                 

Definition
Os09g0530200
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:osa00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 515 aa AA seqDB search
MALLSAPVRRRRSRVRVLLVCCCLLLALAAPSAAAAAAGHDYGDALAKSILFFEGQRSGR
LPAAGQRAAWRGDSAVSDGGAAGVDLEGGYYDAGDNVKFGFPMAFTATMLAWGVVEFGDA
MPPAERAHAADAVRWATDYLLKTISHPGVIFIQVGDPTKDHGCWERPEDMDTARTVYNIS
AARPGSDVAGETAAALAAASMVFRDDDPAYAARLLAGARSAFEFADEHKGAYSDDPELRA
GGCPFYCDFDGYQDELLWGAAWLRRASKEGTYLDYIQNNGKTLGAEDSTNEFGWDNKHAG
INVLVSKEFIDGEVLSLQSYKEFADGFICTLIPESSSPHITYTPGGMIYKPGGSNMQHVT
SISFLLLTYAKYLSNSSRTVNCGNVSVGPATLQQLARKQADYILGDNPMKMSYMVGYGDR
YPQRIHHRGSSLPSIKSHPQRIACNDGTPYYNSSSPNPNPLIGAVVGGPGEDDVYEDDRA
DFRKSEPTTYINAPLVGVLAYLVGNPDPGQGHVRH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcctctcggctcccgtgcgccgccgccgctcgcgcgtgcgtgtcctgctagtg
tgctgctgcttgctactggcgctcgcggcgccgtcggcggcggcggcggcggcggggcat
gactacggcgacgcgctggccaagtcgatcctgttcttcgaggggcagcggtcggggcgg
ctgccggcggcggggcagcgcgcggcgtggcgaggggactcggcggtgtcggacggcggc
gcggcgggcgtcgacctggagggcgggtactacgacgccggcgacaacgtcaagttcggc
ttcccgatggcgttcaccgccacgatgctggcgtggggcgtcgtcgagttcggcgacgcc
atgccgcccgcggagcgcgcccacgccgccgacgccgtccgctgggccaccgactacctc
ctcaagaccatctcccaccccggcgtcatcttcattcaggtgggcgacccaacgaaggac
cacgggtgctgggagcggccggaggacatggacacagcgaggacggtgtacaacatcagc
gcggcgaggccggggtcggacgtggccggggagacggcggcggcgctggccgcggcgtcg
atggtgttccgcgacgacgacccggcgtacgccgcgcggctgctcgccggcgccaggagc
gcgttcgagttcgcggacgaacacaagggcgcgtacagcgacgacccggagctcagggcc
ggcggctgcccgttctactgcgacttcgatggatatcaggatgagctgctgtggggagca
gcatggctacggagagcctccaaggaaggcacctacctcgactacattcagaacaacggc
aagacccttggagcagaggatagcaccaacgaattcggctgggacaacaagcatgccggc
atcaatgtccttgtctccaaggagttcatagatggcgaggtgctatctctgcaatcctac
aaggagtttgcagatggattcatctgcacactgattccggagtcgtcgtctccgcacatc
acgtacacgcccgggggcatgatctacaagcctggaggcagcaacatgcagcatgttaca
tccatttcgttcctgctcctgacttatgccaagtacctctccaattcctcgcgcactgtc
aactgtggaaatgtttcggttggtcctgccactcttcagcagctagccagaaagcaggct
gattatatattaggagataacccgatgaaaatgtcatacatggtcgggtacggcgatcgg
tatcctcaacggatacaccatcgaggatcatcgttgccttcgatcaagagccatccccag
cgcattgcgtgcaacgacggcacgccttactacaattcatctagcccgaacccaaacccg
ttaattggcgcagttgttggggggcctggggaggatgatgtttatgaggatgaccgtgcc
gatttcaggaaatctgaaccaactacctacatcaatgctccattggtaggagttcttgct
taccttgttggcaatcctgatccaggccaaggccatgtcaggcattga

DBGET integrated database retrieval system