KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347691Help
Entry
4347691           CDS       T01015                                 

Definition
(RefSeq) triosephosphate isomerase, chloroplastic
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00051  Fructose and mannose metabolism
osa00562  Inositol phosphate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4347691
   00051 Fructose and mannose metabolism
    4347691
   00562 Inositol phosphate metabolism
    4347691
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4347691
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     4347691
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4347691
  Exosomal proteins of bladder cancer cells
   4347691
  Exosomal proteins of melanoma cells
   4347691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 4347691
NCBI-ProteinID: XP_015612500
UniProt: Q69K00
Position
9
AA seq 304 aa AA seqDB search
MAAPSSLASSHLSRLADLRRAGVAAAAPAHPQQLRLGCSRRRAQRVVAMAGSGKFFVGGN
WKCNGTKDSVSKLVTELNAATLEPDVDVVVAPPFIYIDQVKNSLTDRIEVSAQNVWIGKG
GAYTGEISAEQLVDIGCQWVILGHSERRHVIGEDDQFIGKKAAYALSQNVKVIACIGELL
EEREAGKTFDVCFKQMKAFADSITNWADVVIAYEPVWAIGTGKVATPEQAQEVHAAVRDW
LKTNVSPEVASGIRIIYGGSVNAANCAELAKKEDIDGFLVGGASLKGPDFATIINSVTSK
KVAA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccgtcgtccctcgcgtcctcccacctctcccgcctcgccgacctccgccgc
gcaggcgtcgccgccgccgccccggcgcatccgcagcagctccgcctcgggtgctcccgc
cgccgcgcccagcgcgtcgtcgccatggccggatccggcaagttcttcgttggaggcaac
tggaagtgcaatggaacgaaggactctgtcagcaagcttgtgactgaattgaatgctgct
acacttgaacctgatgttgatgttgtggttgcaccaccattcatttatattgatcaggtt
aagaactcactaactgatcgtattgaggtatctgctcagaatgtttggattggaaaagga
ggagcatacactggagagatcagtgcggagcaattggtggacattggctgccaatgggtt
attcttgggcattcagagcgtagacatgtcattggtgaagatgatcagtttattgggaag
aaggctgcatatgccttgagtcaaaatgtaaaggttattgcctgcataggggagctgttg
gaagagagagaagcagggaaaacttttgacgtctgttttaagcagatgaaggcttttgca
gacagtattacaaactgggcggatgtagtaattgcatatgagcctgtttgggctattgga
accgggaaagttgctactcctgagcaagctcaggaagttcatgctgctgttcgtgattgg
ttgaaaaccaacgtgtcacctgaggttgcttccggcattcgaattatatatggaggttct
gtaaatgcagccaattgtgccgagctagcaaagaaagaagatattgacggcttccttgtt
ggtggtgcctctttgaagggtccggattttgccactattatcaactcggtgacttccaag
aaagttgcagcctga

DBGET integrated database retrieval system