KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347800Help
Entry
4347800           CDS       T01015                                 

Definition
Os09g0553200
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4347800
   00052 Galactose metabolism
    4347800
   00500 Starch and sucrose metabolism
    4347800
   00520 Amino sugar and nucleotide sugar metabolism
    4347800
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     4347800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 469 aa AA seqDB search
MAVTADVKLEGLRAATDKLDQISENEKSGFISLVSRYLSGEAEQIEWSKIQTPTDEVVVP
YDTLSAAPEDLNETKKLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIE
SLNKKYGCNVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDFLPLPSK
GKTGKDGWYPPGHGDVFPSLNNSGKLDTLLAQGKEYVFVANSDNLGAIVDIKILNHLIHN
QNEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWV
NLKAIKRLVEAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAIGINVPRSRFLPV
KATSDLLLVQSDLYTLVDGFVIRNPARTNPSNPSIELGPEFKKVANFLARFKSIPSIVEL
DTLKVSGDVWFGSGVTLKGKVTITAKSGKLEIPDGAVLENKDINGPEDL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaccgccgacgtgaagctcgagggcctccgcgccgccaccgacaagctcgac
cagatcagcgagaacgagaagtccgggttcatcagcctcgtttcgcgctacctcagcggc
gaggcggagcagatcgagtggagtaagatccagaccccgaccgacgaggtggtggttccc
tacgacacgctctcggctgctcccgaagatctcaacgagacgaagaagctgctcgacaaa
ctcgtcgtgctcaagctcaatggaggcctcgggacgaccatgggctgcactggtcccaag
tctgtcattgaagtccgcaatggctttacgtttctagaccttattgtgattcaaattgag
tccctgaacaagaagtatggatgcaatgtccctttgcttctaatgaactcattcaacact
catgatgacacacagaagattgttgagaagtactccaactccaacattgaaattcacact
ttcaaccagagccaatatcctcgcattgttactgaagacttcttgccacttccaagcaag
gggaagactggcaaggatggctggtatcccccaggccatggtgatgtgttcccctccttg
aataacagtggaaaacttgataccttgttggcacagggcaaggagtatgtctttgtcgcg
aactcggacaacttgggtgctattgttgacatcaagatcttaaaccacctgatccataac
cagaacgagtactgtatggaggttactcctaaaacattggctgatgttaaaggtggtacc
ctcatctcttacgaagggagagttcagctgttggagattgctcaagtccctgatgagcat
gtgaatgaattcaagtcaattgagaagttcaagatcttcaataccaacaacctgtgggtg
aacttgaaggccatcaagaggctggtagaagctgaagcacttaagatggaaatcattcct
aaccctaaggaagttgatggtgtgaaagttctgcaactcgaaactgcagctggagcagcc
attcggttctttgaaaaagcaattggcattaatgttccccgctcgagatttctgccagtc
aaggctacatctgatttgttgcttgtacagtctgatttgtacaccttggtcgatggcttt
gtcatccgcaacccagccagaacaaacccatcaaacccttcgattgagcttggacctgag
ttcaagaaggttgccaatttcctggcccggtttaagtcaatccccagcattgtcgagctt
gacaccttgaaggtctctggtgatgtctggttcggctctggagttacactcaagggtaag
gtgaccatcaccgccaagtcagggaagttggagatcccagatggagccgtgcttgagaac
aaggacatcaacggtccggaggatctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system