KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348152Help
Entry
4348152           CDS       T01015                                 

Definition
(RefSeq) alcohol dehydrogenase-like 4
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4348152
  Lipid metabolism
   00071 Fatty acid degradation
    4348152
  Amino acid metabolism
   00350 Tyrosine metabolism
    4348152
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4348152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C ADH_zinc_N_2 UDPG_MGDP_dh_N TrkA_N
Motif
Other DBs
NCBI-GeneID: 4348152
NCBI-ProteinID: XP_015612744
UniProt: Q10A46
Position
10
AA seq 403 aa AA seqDB search
MDATAIGNGALHSNGAGADTKGKPIKCKAAVAHGPGEALVMEEVEVAPPARMEVRLKVLF
TSICHTDLSAWKGENELQRKFPRILGHEAAGVVESVGEGVEDLAPGDHVVPIFTGECGAC
TYCESSKSNLCKTYRVNPFKSTMVTDGGTRFTMIDRSSGARNPVYHFLNTSTFAEYTVID
SACAVKINPKAPLEKMSLLSCGVSTGVGAAWNTANVSKGSTVAIFGLGAIGLAVAEGARL
RGASRIIGVDINPEKFSKGKEMGITDFINSKASGKPVHEVIMEMTDGGVDYSFECTGITD
VLREAFVSTHDGWGLTVVLGIHATPRMLPLHPMELFDGRRITGCVFGDFKGKSQLPEIVE
KCMQGEININFDGFITQELPFADINKAFQLLEEGKSLRCLLHV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggatgccactgccatcggcaacggcgccctgcactccaatggcgccggcgccgacacc
aaagggaagccgatcaaatgcaaagcggcggtggcgcacggccccggcgaggcgctggtg
atggaggaggtggaggtggcgccgccggcgaggatggaggtgcgcctcaaggtgctcttc
acctctatctgccataccgacctcagcgcctggaaaggagagaacgagcttcagcgaaag
tttcctcgcatattgggtcatgaggcagcaggggtggtggagagcgtgggagagggtgtg
gaggatcttgcccctggagatcatgttgtccccatcttcaccggcgagtgtggtgcgtgc
acctactgcgagtccagcaagagcaacctatgcaaaacctaccgtgtcaacccattcaag
agcaccatggtcaccgatggtggcacgaggttcaccatgatcgaccgctcctccggtgca
cgcaacccggtctaccattttctcaacacttccacctttgctgagtacactgtgattgac
tccgcttgcgctgtcaagatcaaccctaaggctcccttggagaagatgagtctcctcagc
tgtggggtctccacaggagtgggagctgcatggaacactgcaaacgtctccaaggggtcc
acagtggcaatatttgggcttggtgccattggtcttgcggttgccgaaggtgccagattg
agaggagcatctcgaatcatcggagttgacataaaccctgaaaaattctccaaaggcaaa
gagatgggcatcactgacttcatcaactcgaaggcatctggcaagcctgtccacgaggtt
atcatggagatgacagatggcggtgtcgactacagcttcgagtgcaccggcatcaccgat
gttctacgggaggccttcgtttccacacatgatggatggggcctgaccgttgtgctgggg
atccatgcaacgcccaggatgctgccgctgcatccaatggagttatttgacggccgtcgg
atcactggctgcgtttttggtgacttcaagggaaagtcccagctgcctgaaatcgtggag
aagtgcatgcagggtgagattaacataaattttgatgggttcataacacaagagttgccc
ttcgccgacatcaacaaagctttccagctgctggaagaggggaagtcactcagatgtctg
ctccatgtctga

DBGET integrated database retrieval system