KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348317Help
Entry
4348317           CDS       T01015                                 

Definition
Os10g0323900
Orthology
K05759  
profilin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 131 aa AA seqDB search
MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE
RLGDYLVEQGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacgtacgtcgacgagcacctgatgtgcgagatcgagggccaccacctc
acctccgccgccatcgtcggccacgacggcaccgtctgggcacagagcgccgccttccct
cagttcaaaccggaggagatgaccaacatcatgaaggacttcgacgagccggggttcctc
gccccgaccggactgtttcttggaccaaccaagtacatggtcatccaaggtgaacctggc
gctgtcattcgtggcaagaagggatcaggaggcatcacagtgaagaagaccgggcaggcg
ctggtggtcggcatctacgacgagcccatgaccccggggcagtgcaacatggtggttgag
aggctcggtgactacctcgtagagcagggcctgtag

DBGET integrated database retrieval system