KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348524Help
Entry
4348524           CDS       T01015                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4348524
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4348524
   00220 Arginine biosynthesis
    4348524
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     4348524
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4348524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 4348524
NCBI-ProteinID: XP_015614438
UniProt: Q338N8
Position
10
AA seq 483 aa AA seqDB search
MAAPSVAVDNLNPKVLNCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSL
GQKPVTFFREVIALCDHPCLLEKEETKSLFSADAISRATTILASIPGRATGAYSHSQGIK
GLRDAIAAGIASRDGYPANADDIFLTDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSA
SIALHGGALVPYYLNESTGWGLEISDLKKQLEDSRLKGIDVRALVVINPGNPTGQVLAEE
NQRDIVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYNEDDLPLVSFQSVSK
GYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYAS
YKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKA
PDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAA
YRD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcccagcgtcgccgtcgacaacctcaaccccaaggttttgaattgtgagtat
gcagtgcgtggagagattgtgatccatgctcagcgcctgcagcaacagctacagactcaa
ccagggtctcttccttttgatgagatcctatactgcaacattgggaatccccagtctctt
ggtcagaagccagttacattcttcagggaggttattgctctttgtgatcatccatgcttg
ttggaaaaggaggaaaccaaatcattgttcagtgctgatgccatttctcgagcaacaaca
attcttgcctcgattcctggaagagcaactggagcatacagccacagccagggcatcaaa
gggctgcgtgatgcaattgctgctggaattgcatcacgtgacggataccctgcaaatgca
gacgacattttccttactgacggagcaagccctggagttcacatgatgatgcagttactg
ataaggaacgagaaagatggcattctctgcccaattcctcaatatcctttgtactcagcc
tccattgctcttcatggtggagctcttgtcccgtattatcttaatgaatcaacaggctgg
ggtttggagatctctgaccttaagaagcaactcgaagattctcggttgaaaggcattgat
gttagggctttggtagttatcaatccaggaaatccaactgggcaggttcttgctgaggaa
aaccaacgggacatagtgaagttctgcaaaaatgagggacttgttcttctggctgatgag
gtgtaccaagagaacatctatgttgacaacaagaaatttaactctttcaagaagatagcg
agatccatgggatacaacgaggatgatctccctttagtatcatttcaatctgtttctaag
ggatattatggtgaatgtggcaaaagaggaggctacatggagattactggcttcagtgct
ccagttagagagcagatctacaaagtggcgtcagtgaacttatgttccaatatcactggc
cagatccttgccagcctcgtcatgaatccaccaaaggctggagatgcatcatatgcttca
tacaaggcagagaaagatggaatcctccaatcattagctcgccgtgcaaaggcattggag
aatgctttcaacagtcttgagggaattacatgcaacaaaactgaaggagcaatgtacctc
ttccctcagcttagtctgccacaaaaggcaattgacgctgctaaagctgctaacaaagca
cctgatgctttctatgcccttcgtctcctcgaggcaaccggaattgttgttgtccctgga
tctggatttggccaagttcctggcacatggcacatcagatgcacaatcctgccacaggag
gagaagatccccgcgatcatctcccgcttcaaggcattccatgagggcttcatggcagcg
taccgcgactga

DBGET integrated database retrieval system