KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348524Help
Entry
4348524           CDS       T01015                                 

Definition
Os10g0390500
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4348524
   01210 2-Oxocarboxylic acid metabolism
    4348524
   01230 Biosynthesis of amino acids
    4348524
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4348524
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4348524
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     4348524
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4348524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 483 aa AA seqDB search
MAAPSVAVDNLNPKVLNCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSL
GQKPVTFFREVIALCDHPCLLEKEETKSLFSADAISRATTILASIPGRATGAYSHSQGIK
GLRDAIAAGIASRDGYPANADDIFLTDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSA
SIALHGGALVPYYLNESTGWGLEISDLKKQLEDSRLKGIDVRALVVINPGNPTGQVLAEE
NQRDIVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYNEDDLPLVSFQSVSK
GYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYAS
YKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKA
PDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAA
YRD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcccagcgtcgccgtcgacaacctcaaccccaaggttttgaattgtgagtat
gcagtgcgtggagagattgtgatccatgctcagcgcctgcagcaacagctacagactcaa
ccagggtctcttccttttgatgagatcctatactgcaacattgggaatccccagtctctt
ggtcagaagccagttacattcttcagggaggttattgctctttgtgatcatccatgcttg
ttggaaaaggaggaaaccaaatcattgttcagtgctgatgccatttctcgagcaacaaca
attcttgcctcgattcctggaagagcaactggagcatacagccacagccagggcatcaaa
gggctgcgtgatgcaattgctgctggaattgcatcacgtgacggataccctgcaaatgca
gacgacattttccttactgacggagcaagccctggagttcacatgatgatgcagttactg
ataaggaacgagaaagatggcattctctgcccaattcctcaatatcctttgtactcagcc
tccattgctcttcatggtggagctcttgtcccgtattatcttaatgaatcaacaggctgg
ggtttggagatctctgaccttaagaagcaactcgaagattctcggttgaaaggcattgat
gttagggctttggtagttatcaatccaggaaatccaactgggcaggttcttgctgaggaa
aaccaacgggacatagtgaagttctgcaaaaatgagggacttgttcttctggctgatgag
gtgtaccaagagaacatctatgttgacaacaagaaatttaactctttcaagaagatagcg
agatccatgggatacaacgaggatgatctccctttagtatcatttcaatctgtttctaag
ggatattatggtgaatgtggcaaaagaggaggctacatggagattactggcttcagtgct
ccagttagagagcagatctacaaagtggcgtcagtgaacttatgttccaatatcactggc
cagatccttgccagcctcgtcatgaatccaccaaaggctggagatgcatcatatgcttca
tacaaggcagagaaagatggaatcctccaatcattagctcgccgtgcaaaggcattggag
aatgctttcaacagtcttgagggaattacatgcaacaaaactgaaggagcaatgtacctc
ttccctcagcttagtctgccacaaaaggcaattgacgctgctaaagctgctaacaaagca
cctgatgctttctatgcccttcgtctcctcgaggcaaccggaattgttgttgtccctgga
tctggatttggccaagttcctggcacatggcacatcagatgcacaatcctgccacaggag
gagaagatccccgcgatcatctcccgcttcaaggcattccatgagggcttcatggcagcg
taccgcgactga

DBGET integrated database retrieval system