KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348629Help
Entry
4348629           CDS       T01015                                 

Definition
Os10g0415900
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     4348629
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     4348629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 511 aa AA seqDB search
MDGLAAPSPSHSGATSGGGASHRKRKLPPSSLSDATADEDDDTTAPSSPSTSPSSPSRPS
SPSSSHSDDDDDDSLHTFTAARLDGAPPSSSGRPPKPESSTVSAAAAAAAAAAAPKPDSA
SAAAGDGKEDPKGLFTDNIQTSGAYSAREEGLKREEEAGRLKFLCYSNDGVDEHMIWLVG
LKNIFARQLPNMPKEYIVRLVMDRTHKSMMVIRNNIVVGGITYRPYTSQKFGEIAFCAIT
ADEQVKGYGTRLMNHLKQHARDADGLTHFLTYADNNAVGYFVKQGFTKEITLDKERWQGY
IKDYDGGILMECRIDQKLPYVDLATMIRRQRQAIDEKIRELSNCHIVYSGIDFQKKEAGI
PRRTMKPEDIQGLREAGWTPDQWGHSKSRSAFSPDYSTYRQQLTNLMRSLLKNMNEHPDA
WPFKEPVDSRDVPDYYDIIKDPIDLKTMSKRVESEQYYVTLEMFVADMKRMFSNAKTYNS
PDTIYYKCASRLESFFSNKVASQLAQASTKN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggacgggctcgcggcgccctcgccgtcccactccggcgcgacgtccggcggcggcgcc
tcccaccgcaagcggaagctcccgccgtcgtccctctccgacgccaccgccgacgaggac
gacgacaccaccgcgccgtcgtcgccgtccacctccccgtcgtcgccctcacgcccgtcc
tccccgtcctcctcccactccgacgatgacgacgacgactccctccacaccttcaccgcc
gcccgcctcgacggcgcgcccccgtcctcatccggccgcccgccgaagcccgagtcctcg
accgtgtctgccgccgccgcggccgcggctgcagcggccgctcccaagcccgattccgct
tccgctgccgccggcgacggcaaggaggacccgaaggggttgttcactgacaacattcag
accagtggcgcgtatagcgctcgagaggagggcctcaagcgtgaggaagaagcagggagg
ctgaaatttctatgctattctaatgatggagttgatgaacatatgatttggttggtaggc
ttgaagaatatctttgctcggcagcttcctaacatgcccaaagagtacattgtccgtctt
gttatggatagaactcacaaatcaatgatggttatcaggaataatattgttgtaggaggc
attacttaccggccttatacaagccagaagtttggagaaatagcattttgtgcaattaca
gctgatgagcaagttaaaggctatgggacacggttaatgaatcacctgaagcaacatgcc
cgagatgctgatgggctcactcatttcttaacttatgcagataacaatgccgttggctat
tttgtaaagcagggtttcacaaaggagatcacattggacaaagaaagatggcaagggtac
attaaagactatgatggaggaatattgatggagtgcagaattgatcaaaagttgccatat
gttgatctggcaacgatgattaggcgtcaaagacaggcaattgatgagaaaatcagagag
ctttcaaactgccatattgtttattctggaattgacttccaaaagaaagaagctggtatt
ccaagaagaacgatgaaaccagaagacatccaaggcttgagggaagctgggtggacgcca
gatcagtgggggcattccaaatcaagatcagccttttctcctgattacagtacttacagg
caacaacttactaatctaatgcgttcattgttgaagaatatgaatgagcatcctgatgct
tggccattcaaagagccagtggattcacgtgatgttcctgactattatgacattatcaaa
gatcctattgatttgaagacaatgtcaaaaagagttgagtctgagcagtattatgtgacg
ctagagatgtttgtagctgacatgaagagaatgttcagcaatgcaaaaacttataactct
cccgatacaatctattacaagtgtgcctcacggctcgagagcttcttctcaaacaaagta
gcatctcagcttgcccaagcctcaacgaagaactga

DBGET integrated database retrieval system