KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348629Help
Entry
4348629           CDS       T01015                                 

Gene name
GCN5
Definition
(RefSeq) histone acetyltransferase GCN5
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     4348629 (GCN5)
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     4348629 (GCN5)
Chromosome [BR:osa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    4348629 (GCN5)
   HAT complexes
    PCAF complex
     4348629 (GCN5)
    STAGA complex
     4348629 (GCN5)
    TFTC complex
     4348629 (GCN5)
    SAGA complex
     4348629 (GCN5)
    SLIK complex
     4348629 (GCN5)
    ADA-HAT complex
     4348629 (GCN5)
    HAT-A2 complex
     4348629 (GCN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
10
AA seq 511 aa AA seqDB search
MDGLAAPSPSHSGATSGGGASHRKRKLPPSSLSDATADEDDDTTAPSSPSTSPSSPSRPS
SPSSSHSDDDDDDSLHTFTAARLDGAPPSSSGRPPKPESSTVSAAAAAAAAAAAPKPDSA
SAAAGDGKEDPKGLFTDNIQTSGAYSAREEGLKREEEAGRLKFLCYSNDGVDEHMIWLVG
LKNIFARQLPNMPKEYIVRLVMDRTHKSMMVIRNNIVVGGITYRPYTSQKFGEIAFCAIT
ADEQVKGYGTRLMNHLKQHARDADGLTHFLTYADNNAVGYFVKQGFTKEITLDKERWQGY
IKDYDGGILMECRIDQKLPYVDLATMIRRQRQAIDEKIRELSNCHIVYSGIDFQKKEAGI
PRRTMKPEDIQGLREAGWTPDQWGHSKSRSAFSPDYSTYRQQLTNLMRSLLKNMNEHPDA
WPFKEPVDSRDVPDYYDIIKDPIDLKTMSKRVESEQYYVTLEMFVADMKRMFSNAKTYNS
PDTIYYKCASRLESFFSNKVASQLAQASTKN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggacgggctcgcggcgccctcgccgtcccactccggcgcgacgtccggcggcggcgcc
tcccaccgcaagcggaagctcccgccgtcgtccctctccgacgccaccgccgacgaggac
gacgacaccaccgcgccgtcgtcgccgtccacctccccgtcgtcgccctcacgcccgtcc
tccccgtcctcctcccactccgacgatgacgacgacgactccctccacaccttcaccgcc
gcccgcctcgacggcgcgcccccgtcctcatccggccgcccgccgaagcccgagtcctcg
accgtgtctgccgccgccgcggccgcggctgcagcggccgctcccaagcccgattccgct
tccgctgccgccggcgacggcaaggaggacccgaaggggttgttcactgacaacattcag
accagtggcgcgtatagcgctcgagaggagggcctcaagcgtgaggaagaagcagggagg
ctgaaatttctatgctattctaatgatggagttgatgaacatatgatttggttggtaggc
ttgaagaatatctttgctcggcagcttcctaacatgcccaaagagtacattgtccgtctt
gttatggatagaactcacaaatcaatgatggttatcaggaataatattgttgtaggaggc
attacttaccggccttatacaagccagaagtttggagaaatagcattttgtgcaattaca
gctgatgagcaagttaaaggctatgggacacggttaatgaatcacctgaagcaacatgcc
cgagatgctgatgggctcactcatttcttaacttatgcagataacaatgccgttggctat
tttgtaaagcagggtttcacaaaggagatcacattggacaaagaaagatggcaagggtac
attaaagactatgatggaggaatattgatggagtgcagaattgatcaaaagttgccatat
gttgatctggcaacgatgattaggcgtcaaagacaggcaattgatgagaaaatcagagag
ctttcaaactgccatattgtttattctggaattgacttccaaaagaaagaagctggtatt
ccaagaagaacgatgaaaccagaagacatccaaggcttgagggaagctgggtggacgcca
gatcagtgggggcattccaaatcaagatcagccttttctcctgattacagtacttacagg
caacaacttactaatctaatgcgttcattgttgaagaatatgaatgagcatcctgatgct
tggccattcaaagagccagtggattcacgtgatgttcctgactattatgacattatcaaa
gatcctattgatttgaagacaatgtcaaaaagagttgagtctgagcagtattatgtgacg
ctagagatgtttgtagctgacatgaagagaatgttcagcaatgcaaaaacttataactct
cccgatacaatctattacaagtgtgcctcacggctcgagagcttcttctcaaacaaagta
gcatctcagcttgcccaagcctcaacgaagaactga

DBGET integrated database retrieval system