KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348852Help
Entry
4348852           CDS       T01015                                 

Gene name
OsJ_31838, p28
Definition
(RefSeq) eukaryotic translation initiation factor isoform 4E-2
  KO
K03259  
translation initiation factor 4E
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    4348852 (OsJ_31838)
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     4348852 (OsJ_31838)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4348852 (OsJ_31838)
Translation factors [BR:osa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    4348852 (OsJ_31838)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
10
AA seq 206 aa AA seqDB search
MAEVEAAPIAAAETPEVAAAEGAAAAKAPHKLHRQWAFWYDIQSKPKPGAAWGTSLRKAY
TFDTVEEFWGLYDQIFRPSKVTVNADFHLFKAGVEPKWEDPECANGGKWTVPCSRKTTLE
NMWLETLMALIGEQFDESEEICGVVASVRQRGDKLALWTRTASNEAVQVNIGKKWKEIVD
YNDKMVYSFHDDAKREKPSRGGRYNV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggtggaggcagcgccgattgcggcggcggagaccccggaggtggcggcggcg
gagggagcggcggcggcgaaggcgccgcacaagctgcataggcagtgggcgttctggtac
gacatccagtccaagcccaagcccggcgccgcgtgggggacctcgctccgcaaggcctac
accttcgacaccgtcgaggagttctggggcttgtatgatcagattttccgtccaagcaag
gtgacagtaaatgctgattttcatttattcaaggctggtgtagaaccaaagtgggaagac
ccagagtgtgcaaatgggggcaaatggactgtgccatgtagcaggaagaccacccttgag
aacatgtggcttgaaacgctgatggctctgattggagagcagtttgatgaaagtgaggaa
atttgtggagttgttgctagtgtccgccagagaggagacaagcttgcattgtggactagg
actgccagcaatgaagccgttcaggtaaacattggcaagaaatggaaggagattgttgac
tacaatgataagatggtctacagcttccatgatgacgccaagagggagaaaccaagcaga
ggtggacggtacaacgtgtaa

DBGET integrated database retrieval system