KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348852Help
Entry
4348852           CDS       T01015                                 

Definition
Os10g0467600
Orthology
K03259  
translation initiation factor 4E
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    4348852
Translation factors [BR:osa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    4348852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 206 aa AA seqDB search
MAEVEAAPIAAAETPEVAAAEGAAAAKAPHKLHRQWAFWYDIQSKPKPGAAWGTSLRKAY
TFDTVEEFWGLYDQIFRPSKVTVNADFHLFKAGVEPKWEDPECANGGKWTVPCSRKTTLE
NMWLETLMALIGEQFDESEEICGVVASVRQRGDKLALWTRTASNEAVQVNIGKKWKEIVD
YNDKMVYSFHDDAKREKPSRGGRYNV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggtggaggcagcgccgattgcggcggcggagaccccggaggtggcggcggcg
gagggagcggcggcggcgaaggcgccgcacaagctgcataggcagtgggcgttctggtac
gacatccagtccaagcccaagcccggcgccgcgtgggggacctcgctccgcaaggcctac
accttcgacaccgtcgaggagttctggggcttgtatgatcagattttccgtccaagcaag
gtgacagtaaatgctgattttcatttattcaaggctggtgtagaaccaaagtgggaagac
ccagagtgtgcaaatgggggcaaatggactgtgccatgtagcaggaagaccacccttgag
aacatgtggcttgaaacgctgatggctctgattggagagcagtttgatgaaagtgaggaa
atttgtggagttgttgctagtgtccgccagagaggagacaagcttgcattgtggactagg
actgccagcaatgaagccgttcaggtaaacattggcaagaaatggaaggagattgttgac
tacaatgataagatggtctacagcttccatgatgacgccaagagggagaaaccaagcaga
ggtggacggtacaacgtgtaa

DBGET integrated database retrieval system