KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348876Help
Entry
4348876           CDS       T01015                                 

Definition
Os10g0473400
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    4348876
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4348876
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     4348876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 974 aa AA seqDB search
MVSGNLFHCRRNSWPAEEYVGRTALQLLDFDGGSPPEQAWRRRLNSHANLLKEFSVTFME
AMRMMSLGLRLWSYVREEASHGRKAPIDPFTKEKCKPSASQGVPLGGMGSGSISRGFRGE
FKNWHIIPGLCETSPVMENQFSIFVSRDGGNKKYSSVLSPGHHEGLKKCNDSGISSWDWN
LSGQHSTYHALFPRAWTVYDGEPDPDLKISCRQISPFIPHDYKDSSLPTSVFVYTLVNTG
KDRAKVSLLMTWANSIGGFSHHSGGHFNEPFIAEDGVSGVLLHHKTAKDNPPVTFAIAAC
ETQNVNVTVLPVFGLSGEGHDSAKQMWDRMKQNGHFDRENFEAGTSMPSSSGETLCAAVS
ASTWVEPHGRCTVVFGLAWSSPKIKFQKGCTYNRRYTEFYGTSERSAVNLVHDALTKYRI
WEEEIEKWQNPILKNEKLPEWYKFTLFNELYFLVAGGTVWTDGQPPVIDEKPSPGSNQQK
SSKRGTRDTKQESVKDNHVKLTAEQVTNGGDLANGEEQSVSKYAAVHGPQMAKATNGLGS
QEPIPYLLSKNGPENVGKFLYLEGVEYIMWCTYDVHFYASFALLDLFPKIELSIQRDFAN
AVLYEDRRRMKFLADGTSGIRKVKGAVPHDLGTHDPWHEMNAYNIHDTSKWKDLNPKFVL
QVYRDFAATGDMSFGRDVWPAVCAVMDYMNQFDRDGDGLIENDGFPDQTYDAWTVHGISA
YCGGLWLAALQAAATMAHRLGDRPFAEKYKLKFIQAKAVYEAKLWNGSYFNYDSGTSSNS
RSIQADQLAGQWYAASSGLPPLFDENKIRSALQKIFEFNVMKVKGGRLGAVNGMTPNGKV
DETCMQSREIWTGVTYGVAANMLLHGMEHQGFTTAEGIFIAGWSEEGYGYWFQTPEGWTI
DGHYRSLIYMRPLAIWAMQWARSPPKAILDAPKVNLMDRIHLSPQMIRAMNEINVRKIAP
DNRCFPSSAFRCEC
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcggcaacctcttccactgccggaggaactcgtggccggccgaggagtacgtc
ggccgaaccgccctgcagttgttggacttcgacggcgggtcgcctccggagcaggcatgg
cggcggcgtctgaacagccacgccaacttactcaaggaattcagcgtcaccttcatggaa
gcaatgaggatgatgagccttggcctgaggctatggtcgtatgtccgagaggaggcttct
catggaaggaaagctccaattgatccgtttaccaaagagaaatgtaagccgtctgcttcg
cagggcgtaccgcttggtgggatggggagtggtagcatttcaagaggtttcaggggagag
ttcaagaattggcatatcattcctggtttatgtgagacttccccggtcatggagaaccag
ttttcaatatttgtatctcgcgatggggggaacaaaaagtactcatcggtattgtctccc
ggacaccatgaaggtttaaagaaatgtaatgactctggaatttcttcatgggactggaac
ttgagcggtcaacattctacctatcatgctttatttcctagggcatggactgtttatgat
ggtgaaccggatccagaccttaaaatctcatgtcgtcagatatcaccattcattcctcat
gattacaaagatagcagcctcccaacttctgtctttgtgtacactctagtgaacactggg
aaagaccgtgcgaaagtgagcctgttaatgacatgggcgaattctatcggaggtttttct
catcactctggaggccattttaatgagcccttcattgcggaggatggagtttcaggagtt
cttctgcatcacaaaacagcaaaggataatcctccggttacttttgctattgctgcctgt
gaaactcagaatgtgaatgtgacagtcttgcctgtatttggcctctctggagaaggccat
gattcagccaagcaaatgtgggatagaatgaaacagaacggccactttgaccgtgaaaat
ttcgaagctggtaccagtatgccttcatcttcaggggagacactttgtgcagctgtctca
gcatcaacctgggtagagccacatggtagatgtactgttgtatttggtttggcttggtcc
tctcctaaaataaagtttcagaagggctgcacatacaacaggaggtacactgaattttat
ggaacttctgaaagatcagctgttaatttggtacacgatgccttgacaaaatataggatt
tgggaagaggagattgagaagtggcaaaaccccatactcaagaatgaaaaacttccagaa
tggtacaagttcacactttttaatgagctttactttctggtagctgggggtactgtttgg
acagatggccaaccaccagttatcgatgaaaaaccaagtcctggttctaatcaacagaaa
tcttcaaaaaggggcactagagacactaaacaggaatcagttaaagataaccatgtcaaa
ctgacagcagagcaagtcactaatggtggtgacctggctaatggcgaagagcaaagtgtg
tcaaagtatgcagcagtacatggaccacaaatggctaaggcaaccaacggacttgggtca
caagagccaattccatacttgctttccaagaatggccctgaaaatgttggcaaatttttg
tacctggaaggagtggaatacatcatgtggtgcacctatgatgtgcatttctatgcttct
tttgctctgcttgatctgtttcccaaaatagagttgagtatccaacgtgattttgccaat
gctgttctctatgaagacagacgaagaatgaaatttttggctgatggtacttctggaatt
cgcaaggtcaaaggtgccgttccgcatgacctaggaacacatgatccatggcatgaaatg
aatgcgtacaacatacatgatacaagcaaatggaaagatctaaatccaaagtttgtgctc
caggtatacagagacttcgctgctacaggtgatatgtcatttggtagagatgtttggcct
gccgtctgtgcagtgatggactatatgaatcaatttgaccgtgacggtgatggtctcatt
gagaatgatgggtttcctgatcaaacctatgatgcttggactgtacacggaattagtgct
tactgtggcggtctctggcttgctgcacttcaggctgcagctacaatggctcatcggctt
ggtgatcggccatttgctgaaaaatacaagctcaaattcatacaagcgaaagcagtatat
gaggctaagttatggaatgggtcttacttcaattatgacagtggcacaagcagtaatagc
cgatctattcaggcggatcagctggcagggcagtggtatgctgcttcttcaggcttgccc
ccgcttttcgatgagaataaaataagaagtgctctgcagaaaatatttgaattcaatgta
atgaaggttaaaggaggacgattgggagctgtaaatggtatgactcctaatgggaaagtg
gatgagacatgcatgcaatctcgggaaatctggaccggtgttacatacggtgttgctgca
aacatgctgctccatggaatggagcatcaaggattcaccactgccgaaggaatttttatt
gctggttggtcagaagaaggatatgggtattggttccaaacaccggaaggctggaccata
gacgggcactacaggtcgctcatctacatgcggcctctcgccatttgggcaatgcaatgg
gcacgttctccacccaaggcaatccttgatgcccccaaggtaaacctgatggacaggata
cacctatccccacaaatgatccgggcaatgaacgagattaatgttagaaagatagcaccc
gacaatagatgtttccctagctctgcatttcgttgtgaatgctga

DBGET integrated database retrieval system