KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348988Help
Entry
4348988           CDS       T01015                                 

Definition
Os10g0493600
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    4348988
  Lipid metabolism
   00561 Glycerolipid metabolism
    4348988
   00600 Sphingolipid metabolism
    4348988
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    4348988
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     4348988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
10
AA seq 417 aa AA seqDB search
MARASSSSSPPSPRLLLLLLVAVAATLLPEAAALGNFTAESRGARWRSRRARRRAFENGL
GRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNF
VPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVD
YLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGD
IADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLL
IGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWN
RQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcctcgagctcctcgtctccgccgtcgccgcgcctcctcctcctcctcctg
gtggcggtggcggcgacgctgctccccgaggcggcggcgctgggcaacttcacggcggag
tcccgcggcgcgcggtggcggtctcgccgcgcgcggcgccgcgccttcgagaacggcctc
ggccgcacgccgcagatggggtggaatagctggaaccacttctactgcgggatcaacgag
cagatcatcagggaaacagctgatgcattggtcaacactggtctggcgaaattggggtac
cagtatgtgaatatagatgattgctgggcagaatatagtagggattcccagggtaacttt
gtgccaaataggcagacgttcccctctggtatcaaggcactggcagattatgtgcatgca
aaagggctgaagcttggcatctacagcgatgccgggtcacaaacatgcagtaacaaaatg
ccaggatcacttgatcatgaagagcaagatgtcaagaccttcgcgtcttggggagttgat
tatctgaagtatgacaactgcaatgatgctggcaggagtgtcatggaaagatacactaga
atgagcaatgccatgaagacctatggaaagaatatcttcttctcactctgtgaatggggg
aaagaaaatcctgctacatgggcaggccgcatgggtaacagctggagaacaactggcgac
atcgccgacaactggggcagtatgacatctcgtgcagacgaaaatgaccaatgggctgcc
tatgctggacctggtggatggaatgatcctgacatgcttgaagtgggaaatggtgggatg
tctgaagctgagtaccggtcacacttcagtatctgggcactagcaaaggctcctcttttg
atcggatgcgatgtgcgctcaatgagccagcagacgaagaacatactcagcaactcggag
gtgatcgctgtcaaccaagatagtctaggtgtccaaggaaagaaagtacaatctgacaac
ggattggaggtttgggccgggccactcagcaacaacaggaaggctgtggtgctctggaac
aggcagtcataccaggcaaccatcactgcacattggtcgaacatcgggctcgctggatcg
gtcgcggtcactgctcgtgatctatgggcgcactcttcgttcgcggctcagggacagata
tcagcatcggtggcgcctcatgactgcaagatgtatgtcttgacaccaaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system