KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348988Help
Entry
4348988           CDS       T01015                                 

Definition
Os10g0493600
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:osa00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:osa00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:osa00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:osa00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
10
AA seq 417 aa AA seqDB search
MARASSSSSPPSPRLLLLLLVAVAATLLPEAAALGNFTAESRGARWRSRRARRRAFENGL
GRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNF
VPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVD
YLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGD
IADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLL
IGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWN
RQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcctcgagctcctcgtctccgccgtcgccgcgcctcctcctcctcctcctg
gtggcggtggcggcgacgctgctccccgaggcggcggcgctgggcaacttcacggcggag
tcccgcggcgcgcggtggcggtctcgccgcgcgcggcgccgcgccttcgagaacggcctc
ggccgcacgccgcagatggggtggaatagctggaaccacttctactgcgggatcaacgag
cagatcatcagggaaacagctgatgcattggtcaacactggtctggcgaaattggggtac
cagtatgtgaatatagatgattgctgggcagaatatagtagggattcccagggtaacttt
gtgccaaataggcagacgttcccctctggtatcaaggcactggcagattatgtgcatgca
aaagggctgaagcttggcatctacagcgatgccgggtcacaaacatgcagtaacaaaatg
ccaggatcacttgatcatgaagagcaagatgtcaagaccttcgcgtcttggggagttgat
tatctgaagtatgacaactgcaatgatgctggcaggagtgtcatggaaagatacactaga
atgagcaatgccatgaagacctatggaaagaatatcttcttctcactctgtgaatggggg
aaagaaaatcctgctacatgggcaggccgcatgggtaacagctggagaacaactggcgac
atcgccgacaactggggcagtatgacatctcgtgcagacgaaaatgaccaatgggctgcc
tatgctggacctggtggatggaatgatcctgacatgcttgaagtgggaaatggtgggatg
tctgaagctgagtaccggtcacacttcagtatctgggcactagcaaaggctcctcttttg
atcggatgcgatgtgcgctcaatgagccagcagacgaagaacatactcagcaactcggag
gtgatcgctgtcaaccaagatagtctaggtgtccaaggaaagaaagtacaatctgacaac
ggattggaggtttgggccgggccactcagcaacaacaggaaggctgtggtgctctggaac
aggcagtcataccaggcaaccatcactgcacattggtcgaacatcgggctcgctggatcg
gtcgcggtcactgctcgtgatctatgggcgcactcttcgttcgcggctcagggacagata
tcagcatcggtggcgcctcatgactgcaagatgtatgtcttgacaccaaactag

DBGET integrated database retrieval system