KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349225Help
Entry
4349225           CDS       T01015                                 

Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     4349225
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   4349225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 4349225
NCBI-ProteinID: XP_015615011
UniProt: Q336X9
Position
10
AA seq 376 aa AA seqDB search
MDSSSGGAGGGGGAQIKGMGTHGGRYVLYNVYGNFFEVSSKYAPPIRPIGRGAYGIVCAA
VNSENGEEVAIKKIGNAFDNHIDAKRTLREIKLLRHMDHENIIAIKDIIRPPRRDNFNDV
YIVSELMDTDLHQIIRSNQPLTDDHCQYFLYQLLRGLKYVHSANVLHRDLKPSNLFLNAN
CDLKIADFGLARTTTETDLMTEYVVTRWYRAPELLLNCSQYTAAIDVWSVGCILGEIVTR
QPLFPGRDYIQQLKLITELIGSPDDSSLGFLRSDNARRYMKQLPQYPRQDFRLRFRNMSA
GAVDLLEKMLVFDPSRRITVDEALHHPYLASLHDINEEPTCPAPFSFDFEQPSFTEEHIK
ELIWRESLAFNPDPPY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggattcctcctccggcggcgcgggcggcggcggcggcgcgcagatcaaggggatgggg
acgcacgggggccgctacgtgctgtacaacgtgtacgggaacttcttcgaggtctcctcc
aagtacgcccctcccatccgccccatcggccggggcgcctacggcattgtctgcgcggct
gttaactcggagaacggcgaggaagttgccatcaagaagattggcaatgcattcgacaac
catatcgatgccaagcggacactgagagaaatcaagctgcttcgccacatggaccacgag
aatattattgccataaaggacataattcgccccccaagaagagacaactttaatgatgtt
tacattgtttctgagttgatggatactgatctccatcagatcatacgctcaaatcaacca
ttgactgatgaccactgccagtacttcctgtaccagttgctacgagggctaaaatatgtg
cactcggcaaatgtcttgcaccgtgatctgaagccaagcaatttgttccttaatgcaaat
tgtgatctcaagattgctgattttgggcttgcaagaaccactacggagactgacctcatg
acagagtatgtggtcactcgttggtatcgagcaccagagctgctgttgaactgctcgcag
tatactgctgctattgatgtctggtcagttggatgcatacttggtgaaattgtgactcgt
caacccctgtttcctggaagggattacattcagcaactaaaattgatcactgagctgata
gggtcgccagatgactcaagcctagggtttcttcggagtgataatgcaagaagatacatg
aaacagctaccacagtacccaaggcaggacttccgcttgcgcttccgcaacatgtctgct
ggtgcagtcgatctgttagagaaaatgctggtgtttgacccaagcagacggataactgtt
gatgaggctcttcatcacccatacttggcttctcttcatgacatcaatgaagaacccacc
tgcccagcacctttcagctttgattttgagcaaccatcctttactgaagaacatataaaa
gaactcatctggagggaatccttggcatttaatccggatcctccctactaa

DBGET integrated database retrieval system