KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349396Help
Entry
4349396           CDS       T01015                                 

Definition
Os10g0563000
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    4349396
  Lipid metabolism
   00062 Fatty acid elongation
    4349396
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     4349396
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4349396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 314 aa AA seqDB search
MMAYALRGAALVGVLLLVVASPALVPVASAVPFIVLHGIGDQCENGGMASFTEMLGEWSG
SKGYCIEIGRGAWDSWLMPLQEQADTVCKKVKKMKELRKGYSIVGLSQGNLIGRAVIEYC
DGGPPVKNFISIGGPHAGTASVPLCGSGIVCVLIDALIKLEIYSNYVQAHLAPSGYLKIP
TDMTDYLKGCKFLPKLNNEIPSERNATYKQRFSSLENLVLIMFEDDAVLIPRETAWFGYY
PDGAFSPVQPPQKTKLYTEDWIGLKALEEAGRVKFVSVPGGHLSISRSDTKKYIVPYLKP
DGSSRFGIRRILSD
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatggcctacgcgctgcgcggtgccgccctcgtcggcgtcctcctcctcgtcgtggcc
tccccggcgctcgtcccggtggcctccgccgtgcccttcatcgtcctgcacgggatcggc
gaccagtgcgagaacggtgggatggcgtccttcaccgaaatgcttggggaatggtccggc
tccaagggatactgcattgaaattggaagaggagcatgggactcttggctgatgccactt
caagagcaggcagacactgtttgcaagaaggtgaagaaaatgaaagaactccgtaaaggt
tacagcatagttggcctttctcaggggaacttaattggtcgggcagtaattgagtactgc
gatggtggaccaccggtaaagaatttcatctcgattggtggtcctcatgctggtacggca
tcagtaccactttgcggttctggcatcgtttgtgttcttattgatgctctgattaaattg
gagatatattcaaactatgtacaggcacaccttgctcctagtggttacctaaagataccc
actgatatgacagattatttgaagggttgcaagtttcttccaaagcttaacaatgagata
ccaagtgaaagaaatgctacgtataaacaaagattcagcagcctggaaaatctagtattg
attatgtttgaggacgacgcagtgttaataccccgggaaacggcatggttcgggtactat
cccgatggcgccttcagtccagtgcagccacctcaaaagacaaagttgtacacggaggac
tggatcggcttgaaggctttggaggaggctgggcgtgttaagttcgtatcagtgccagga
ggtcacctgagcatctccagaagtgacacgaagaagtacatagtgccatacttgaaaccg
gacggatcatccaggttcggcattcgtcgcatcttgtcggattga

DBGET integrated database retrieval system