KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349396Help
Entry
4349396           CDS       T01015                                 

Definition
Os10g0563000
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:osa01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:osa00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 314 aa AA seqDB search
MMAYALRGAALVGVLLLVVASPALVPVASAVPFIVLHGIGDQCENGGMASFTEMLGEWSG
SKGYCIEIGRGAWDSWLMPLQEQADTVCKKVKKMKELRKGYSIVGLSQGNLIGRAVIEYC
DGGPPVKNFISIGGPHAGTASVPLCGSGIVCVLIDALIKLEIYSNYVQAHLAPSGYLKIP
TDMTDYLKGCKFLPKLNNEIPSERNATYKQRFSSLENLVLIMFEDDAVLIPRETAWFGYY
PDGAFSPVQPPQKTKLYTEDWIGLKALEEAGRVKFVSVPGGHLSISRSDTKKYIVPYLKP
DGSSRFGIRRILSD
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatggcctacgcgctgcgcggtgccgccctcgtcggcgtcctcctcctcgtcgtggcc
tccccggcgctcgtcccggtggcctccgccgtgcccttcatcgtcctgcacgggatcggc
gaccagtgcgagaacggtgggatggcgtccttcaccgaaatgcttggggaatggtccggc
tccaagggatactgcattgaaattggaagaggagcatgggactcttggctgatgccactt
caagagcaggcagacactgtttgcaagaaggtgaagaaaatgaaagaactccgtaaaggt
tacagcatagttggcctttctcaggggaacttaattggtcgggcagtaattgagtactgc
gatggtggaccaccggtaaagaatttcatctcgattggtggtcctcatgctggtacggca
tcagtaccactttgcggttctggcatcgtttgtgttcttattgatgctctgattaaattg
gagatatattcaaactatgtacaggcacaccttgctcctagtggttacctaaagataccc
actgatatgacagattatttgaagggttgcaagtttcttccaaagcttaacaatgagata
ccaagtgaaagaaatgctacgtataaacaaagattcagcagcctggaaaatctagtattg
attatgtttgaggacgacgcagtgttaataccccgggaaacggcatggttcgggtactat
cccgatggcgccttcagtccagtgcagccacctcaaaagacaaagttgtacacggaggac
tggatcggcttgaaggctttggaggaggctgggcgtgttaagttcgtatcagtgccagga
ggtcacctgagcatctccagaagtgacacgaagaagtacatagtgccatacttgaaaccg
gacggatcatccaggttcggcattcgtcgcatcttgtcggattga

DBGET integrated database retrieval system