KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349446Help
Entry
4349446           CDS       T01015                                 

Definition
Os10g0569200
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    4349446
Translation factors [BR:osa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    4349446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 719 aa AA seqDB search
MALEISMEGIEARARELGVDLSTVDLDSVTLPAGEDFGILSDDEDLLRIDDPMELEMGFA
NVVVVDNLPVVPPEKFEKLENVIRKIYSQIGAIKEGGLWMPVNPETKKTYGYCFIEYNTP
QEAELAREKTNGYKLDKSHIFAVNMFDDFDKYMKVPDEWMPAEIKPYTPGENLQKWLADE
KARDQFVIRAGTFTEVYWNDARQKMPELVFQKQYWTDSFIQWSPLGTYLATVHRQGSQVW
GGDDKFERLMRFAHAQVKLIDFSPGEKYLVTYSSHEPSNPRDTHRVVLNIFDVRTGKVMR
DFKGSADEFSASGNISVSGVSWPIFRWGGGKDDKYFARLGKNVISVYETETFSLLDKKSL
KVENVVDFCWSPTDPIIALFVPELGGGNQPARVSLVQIPGKEELRQKNLFSVSDCKMYWQ
NSGEYLAVQVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRF
AVIHGDGPKPDISFYSMKTSNNISRVSKLTTLKGKQANALFWSPGGRFIVFAGLKGFNGQ
LEFYNVDELETMATGEHFMATDIMWDPTGRYLASAVTSVHEMENGFQIWSFSGKQLYKVS
KDHFFQFLWRPRPPSLLTPEKEDEIAKNLRKYSKKYEQEDQDAFNQLSEQERKRRKQLQE
EWEGWVAKWKQLHEEERPYRMELRDGEASDDEEEYDTKEVEIEEEVDVQEEVPFELDQE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcgctagaaatctccatggaaggcatcgaagcgcgggcgcgggagcttggggtcgac
ctctccaccgtcgatctcgactccgtcaccctccccgccggcgaggacttcggcatcctc
agtgacgatgaggatttacttcggattgatgaccctatggagcttgaaatggggtttgct
aacgttgttgtcgtggacaacctgcccgttgttccaccagagaagtttgagaagttggag
aacgtcatacgcaagatctacagtcaaattggtgcgatcaaagaaggtggtctttggatg
cctgtaaacccagagacaaagaagacatacggttactgcttcatcgagtataatacccca
caggaagctgagcttgctagggaaaagacaaatgggtacaagctcgacaagtctcacatc
tttgcagttaacatgtttgatgactttgacaagtacatgaaagttccagacgaatggatg
cctgctgaaattaagccatacactcctggagagaacttgcaaaaatggctggctgatgag
aaggcccgggaccaatttgttatccgtgctggtactttcactgaagtttactggaatgat
gcaaggcagaagatgcctgaacttgtgttccaaaagcagtactggacagacagttttatt
cagtggtcccctcttggaacatacttggcaacagtgcataggcagggctcccaggtgtgg
ggtggcgacgataagtttgagcgtctaatgcgatttgctcatgcacaggtgaaactgatt
gacttctcccctggtgagaaatatttggtcacatatagtagccacgagcccagcaaccct
agagacactcatagggttgttcttaatatctttgatgtgaggactggcaaagtgatgcgc
gactttaaaggaagtgctgatgaattcagtgccagtggaaatatcagtgtttctggtgtt
tcatggcctattttcagatggggtggtggaaaagacgataaatattttgcaaggcttggg
aagaatgttatatctgtctatgagactgaaacattctcccttcttgataagaaatctctg
aaggttgagaatgttgtcgacttctgctggtctccaactgatccaatcatagcccttttt
gtccctgagttgggtggaggaaaccagcctgcaagggtgagccttgtgcaaattcctggc
aaagaggagctgcggcagaaaaaccttttcagtgtcagtgattgcaagatgtactggcag
aacagtggagaatatcttgctgtccaggttgatagatacacaaaaaccaagaagagtact
tacactggatttgagctttttagaattaaggaaagggacatacccattgaggttcttgaa
ttggacaacaagaacgataagatcattgcctttgcatgggagcccaaaggtcaccgcttt
gctgttattcatggtgatggccctaagcctgatataagcttctactccatgaaaacatcc
aacaacatcagtcgtgtgtccaagctcaccactctcaagggcaagcaggctaatgcattg
ttctggtctcctggtggaagattcattgttttcgctggtctgaagggctttaatgggcag
ctggagttttacaatgttgatgagcttgagacgatggcaacgggtgaacatttcatggct
actgacattatgtgggatcctactggaagatatcttgcatctgcagttacctcagtccat
gaaatggagaatggtttccaaatatggtctttcagtggcaagcaactttacaaggtgtca
aaggaccacttctttcagttcctgtggcgtccgagaccaccgtcgctgctgacccctgaa
aaggaagacgagattgcgaagaacctgaggaagtacagcaagaagtacgagcaagaggat
caggatgccttcaaccagctgagcgagcaggaacgcaagaggcggaagcagcttcaggag
gaatgggaaggatgggttgccaagtggaagcagctgcacgaggaagagagaccatacagg
atggagctcagagacggggaggccagtgacgatgaggaagagtacgacaccaaggaagtt
gagattgaagaggaggtagacgtccaagaagaagttccattcgagctggatcaggagtga

DBGET integrated database retrieval system