KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349546Help
Entry
4349546           CDS       T01015                                 

Definition
Os11g0104900
Orthology
K04646  
clathrin heavy chain
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4349546
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4349546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 49 aa AA seqDB search
CFILQVVQRFQELFAQTKYKEAAELAAESPQGLLRTPETVAKFQVHFCS
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
tgctttatattgcaggttgtgcaaaggtttcaagaattgtttgcacaaacaaaatacaag
gaagcagctgagttggctgcagaatctcctcaaggtcttctccgaactcctgagactgtt
gcaaaatttcaggtgcatttctgctcttga

DBGET integrated database retrieval system