KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350002Help
Entry
4350002           CDS       T01015                                 

Gene name
OsJ_33281, OsPDIL1-1, PDI, PDIL1-1
Definition
(RefSeq) protein disulfide isomerase-like 1-1
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4350002 (OsJ_33281)
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4350002 (OsJ_33281)
Chaperones and folding catalysts [BR:osa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   4350002 (OsJ_33281)
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4350002 (OsJ_33281)
  Exosomal proteins of colorectal cancer cells
   4350002 (OsJ_33281)
  Exosomal proteins of bladder cancer cells
   4350002 (OsJ_33281)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 512 aa AA seqDB search
MAISKAWISLLLALAVVLSAPAARAEEAAAAEEGGDAAAEAVLTLDADGFDEAVAKHPFM
VVEFYAPWCGHCKKLAPEYEKAAQELSKHDPPIVLAKVDANDEKNKPLATKYEIQGFPTL
KIFRNQGKNIQEYKGPREAEGIVEYLKKQVGPASKEIKSPEDATNLIDDKKIYIVGIFSE
LSGTEYTNFIEVAEKLRSDYDFGHTLHANHLPRGDAAVERPLVRLFKPFDELVVDSKDFD
VTALEKFIDASSTPKVVTFDKNPDNHPYLLKFFQSSAAKAMLFLNFSTGPFESFKSVYYG
AAEEFKDKEIKFLIGDIEASQGAFQYFGLREDQVPLIIIQDGESKKFLKAHVEPDQIVSW
LKEYFDGKLSPFRKSEPIPEVNDEPVKVVVADNVHDFVFKSGKNVLVEFYAPWCGHCKKL
APILDEAATTLKSDKDVVIAKMDATANDVPSEFDVQGYPTLYFVTPSGKMVPYESGRTAD
EIVDFIKKNKETAGQAKEKAESAPAEPLKDEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctcgaaggcttggatctcgctgctgctcgcgctcgccgtggtgctgtcggcg
ccggcggcgagggcggaggaggcggcggctgcggaggaggggggcgatgcggcggcggag
gccgtgctgacgcttgacgcggacggcttcgatgaggccgtcgccaagcacccgttcatg
gtcgtcgagttctacgccccgtggtgtggacactgcaagaagctcgctccagagtatgag
aaagctgcacaagagctaagcaagcacgatccaccgattgttcttgccaaggttgatgcc
aacgacgagaagaacaagcctcttgctaccaagtatgagatccagggtttcccgacactc
aagatattcaggaaccagggcaagaacattcaggaatacaagggcccgagggaggctgag
ggcattgttgaatacttgaagaagcaggttggtcctgcttccaaggagatcaagtcacca
gaagacgcaaccaaccttattgatgacaagaaaatctacattgttggaatcttctcagaa
ttaagtggcactgagtatacaaacttcatagaggttgctgagaagctgagatctgattat
gactttggccacaccttgcatgccaaccaccttccacgcggtgatgctgcagttgagaga
ccattggttaggctattcaagccctttgatgagcttgttgttgacagcaaggattttgat
gttactgctttggagaagttcattgatgctagcagcacccctaaagttgttacttttgac
aagaaccctgacaaccatccttaccttctgaaatttttccaaagctcagctgccaaggct
atgctatttttgaacttctccactggaccgtttgagtctttcaagtcagtttattatggt
gctgctgaggagttcaaggacaaggaaattaagttcctcattggtgacattgaggccagt
caaggtgccttccagtactttgggctgagggaggatcaggtaccactcatcatcatccag
gatggtgagtccaagaaatttttgaaggcacacgttgagcctgaccaaattgtttcttgg
ttgaaggaatactttgatggtaaattgtctccattcaggaagtctgaacctattcctgag
gtcaacgacgagcctgttaaggttgtggtcgctgataacgtccatgattttgtcttcaag
tctggcaaaaacgtccttgttgaattctatgcaccatggtgcggacactgcaagaagctg
gctccaatcttggatgaggcagctacgacgcttaaaagcgacaaggatgttgtcatcgct
aagatggatgcaactgcgaacgatgtgccaagcgagttcgatgtgcaaggttaccccacc
ctgtacttcgtcacccccagtggaaagatggttccctatgaaagcggcaggacagccgac
gagatcgtcgacttcattaagaagaacaaggaaaccgctggtcaggcgaaggagaaggca
gagtcggccccagccgagcctctcaaggatgagctctaa

DBGET integrated database retrieval system