KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350002Help
Entry
4350002           CDS       T01015                                 

Definition
Os11g0199200
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4350002
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4350002
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4350002
  Exosomal proteins of colorectal cancer cells
   4350002
  Exosomal proteins of bladder cancer cells
   4350002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 512 aa AA seqDB search
MAISKAWISLLLALAVVLSAPAARAEEAAAAEEGGDAAAEAVLTLDADGFDEAVAKHPFM
VVEFYAPWCGHCKKLAPEYEKAAQELSKHDPPIVLAKVDANDEKNKPLATKYEIQGFPTL
KIFRNQGKNIQEYKGPREAEGIVEYLKKQVGPASKEIKSPEDATNLIDDKKIYIVGIFSE
LSGTEYTNFIEVAEKLRSDYDFGHTLHANHLPRGDAAVERPLVRLFKPFDELVVDSKDFD
VTALEKFIDASSTPKVVTFDKNPDNHPYLLKFFQSSAAKAMLFLNFSTGPFESFKSVYYG
AAEEFKDKEIKFLIGDIEASQGAFQYFGLREDQVPLIIIQDGESKKFLKAHVEPDQIVSW
LKEYFDGKLSPFRKSEPIPEVNDEPVKVVVADNVHDFVFKSGKNVLVEFYAPWCGHCKKL
APILDEAATTLKSDKDVVIAKMDATANDVPSEFDVQGYPTLYFVTPSGKMVPYESGRTAD
EIVDFIKKNKETAGQAKEKAESAPAEPLKDEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctcgaaggcttggatctcgctgctgctcgcgctcgccgtggtgctgtcggcg
ccggcggcgagggcggaggaggcggcggctgcggaggaggggggcgatgcggcggcggag
gccgtgctgacgcttgacgcggacggcttcgatgaggccgtcgccaagcacccgttcatg
gtcgtcgagttctacgccccgtggtgtggacactgcaagaagctcgctccagagtatgag
aaagctgcacaagagctaagcaagcacgatccaccgattgttcttgccaaggttgatgcc
aacgacgagaagaacaagcctcttgctaccaagtatgagatccagggtttcccgacactc
aagatattcaggaaccagggcaagaacattcaggaatacaagggcccgagggaggctgag
ggcattgttgaatacttgaagaagcaggttggtcctgcttccaaggagatcaagtcacca
gaagacgcaaccaaccttattgatgacaagaaaatctacattgttggaatcttctcagaa
ttaagtggcactgagtatacaaacttcatagaggttgctgagaagctgagatctgattat
gactttggccacaccttgcatgccaaccaccttccacgcggtgatgctgcagttgagaga
ccattggttaggctattcaagccctttgatgagcttgttgttgacagcaaggattttgat
gttactgctttggagaagttcattgatgctagcagcacccctaaagttgttacttttgac
aagaaccctgacaaccatccttaccttctgaaatttttccaaagctcagctgccaaggct
atgctatttttgaacttctccactggaccgtttgagtctttcaagtcagtttattatggt
gctgctgaggagttcaaggacaaggaaattaagttcctcattggtgacattgaggccagt
caaggtgccttccagtactttgggctgagggaggatcaggtaccactcatcatcatccag
gatggtgagtccaagaaatttttgaaggcacacgttgagcctgaccaaattgtttcttgg
ttgaaggaatactttgatggtaaattgtctccattcaggaagtctgaacctattcctgag
gtcaacgacgagcctgttaaggttgtggtcgctgataacgtccatgattttgtcttcaag
tctggcaaaaacgtccttgttgaattctatgcaccatggtgcggacactgcaagaagctg
gctccaatcttggatgaggcagctacgacgcttaaaagcgacaaggatgttgtcatcgct
aagatggatgcaactgcgaacgatgtgccaagcgagttcgatgtgcaaggttaccccacc
ctgtacttcgtcacccccagtggaaagatggttccctatgaaagcggcaggacagccgac
gagatcgtcgacttcattaagaagaacaaggaaaccgctggtcaggcgaaggagaaggca
gagtcggccccagccgagcctctcaaggatgagctctaa

DBGET integrated database retrieval system