KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350055Help
Entry
4350055           CDS       T01015                                 

Gene name
Adh3
Definition
(RefSeq) alcohol dehydrogenase 2
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4350055 (Adh3)
  Lipid metabolism
   00071 Fatty acid degradation
    4350055 (Adh3)
  Amino acid metabolism
   00350 Tyrosine metabolism
    4350055 (Adh3)
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4350055 (Adh3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
11
AA seq 380 aa AA seqDB search
MATAGKVIKCKAAVAWEAGKPLSIEEVEVAPPQAMEVRLKILYTALCHTDVYFWEAKGQT
PVFPRIFGHEAGGIVESVGEGVTELSPGDHVLPVFTGECGDCRHCLSEESNLCDLLRINT
DRGAMIGDGQTRFTARGGQPVYHFLGTSTFSEYTVVHVGCVAKIHPAAPLDKVCVLSCGI
STGFGATVNVAKPPKGCTVAIFGLGAVGLAAMEGARISGASRIIGVDLNPAKFELAKKFG
CTDFVNPKDYDKPVQQVIIEMTNGGVDRSVECTGNAAAMISAFECVHDGWGVAVLVGVAG
KDAAFKTHPTNFLNERTLRGTFFGNYKPRTDLPGVVEMYMNKELELEKFITHSVPFSEIN
TAFDLMLSGESLRCIIRMED
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgcagggaaagtgatcaagtgcaaagcggcggtggcttgggaggccgggaag
ccgctgtcaatcgaggaggtggaggttgcgccgccgcaagccatggaggttcgcctcaag
atcctctacacggcgctctgccacaccgacgtctacttctgggaagccaaggggcaaact
ccggtgttccctcggatcttcggccacgaagctggagggattgtggagagtgtgggcgag
ggggtgacggagctttcccccggcgaccacgtgctgccggtgttcaccggcgagtgcggc
gactgccggcactgcctgtcggaggagagcaacctgtgcgacctcctccgcatcaacacc
gaccgtggcgccatgatcggcgacggccagaccaggttcaccgccaggggagggcagccg
gtgtaccacttcctcggcacctccacgttcagcgagtacaccgtcgtccatgtcggctgc
gtcgccaagatccacccagcggcgccgctcgacaaggtctgcgtcctcagctgtggcatc
tccaccggatttggcgcgactgtgaacgtcgccaagccaccgaaggggtgcacagtagcc
atattcggcctgggtgcagttggtcttgctgccatggaaggtgcaaggatctctggtgct
tcacggattattggcgtcgatttgaacccggccaaattcgaactagctaagaagtttggg
tgcacagactttgtgaacccaaaagattacgacaagcccgttcagcaggtgatcatcgag
atgaccaacggcggcgtggaccgcagcgtggagtgcaccggcaacgccgccgccatgatc
tccgccttcgagtgcgtccacgacgggtggggagtggccgtgctggtgggcgtcgccggc
aaggacgcggcgttcaagacgcacccgaccaacttcctcaacgagaggacgctcaggggc
acgttcttcggcaactacaagcctcgcaccgacctgcccggcgtcgtcgagatgtacatg
aacaaggagctggagctggagaagttcatcacgcacagcgtgcccttctccgagatcaac
acggcgttcgacctgatgctcagtggggagagcctccgctgcatcatcaggatggaggac
tag

DBGET integrated database retrieval system