KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350055Help
Entry
4350055           CDS       T01015                                 

Definition
Os11g0210600
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:osa01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:osa00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:osa00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:osa00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 297 aa AA seqDB search
ELSPGDHVLPVFTGECGDCRHCLSEESNLCDLLRINTDRGAMIGDGQTRFTARGGQPVYH
FLGTSTFSEYTVVHVGCVAKIHPAAPLDKVCVLSCGISTGFGATVNVAKPPKGCTVAIFG
LGAVGLAAMEGARISGASRIIGVDLNPAKFELAKKFGCTDFVNPKDYDKPVQQVIIEMTN
GGVDRSVECTGNAAAMISAFECVHDGWGVAVLVGVAGKDAAFKTHPTNFLNERTLRGTFF
GNYKPRTDLPGVVEMYMNKELELEKFITHSVPFSEINTAFDLMLSGESLRCIIRMED
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gagctttcccccggcgaccacgtgctgccggtgttcaccggcgagtgcggcgactgccgg
cactgcctgtcggaggagagcaacctgtgcgacctcctccgcatcaacaccgaccgtggc
gccatgatcggcgacggccagaccaggttcaccgccaggggagggcagccggtgtaccac
ttcctcggcacctccacgttcagcgagtacaccgtcgtccatgtcggctgcgtcgccaag
atccacccagcggcgccgctcgacaaggtctgcgtcctcagctgtggcatctccaccgga
tttggcgcgactgtgaacgtcgccaagccaccgaaggggtgcacagtagccatattcggc
ctgggtgcagttggtcttgctgccatggaaggtgcaaggatctctggtgcttcacggatt
attggcgtcgatttgaacccggccaaattcgaactagctaagaagtttgggtgcacagac
tttgtgaacccaaaagattacgacaagcccgttcagcaggtgatcatcgagatgaccaac
ggcggcgtggaccgcagcgtggagtgcaccggcaacgccgccgccatgatctccgccttc
gagtgcgtccacgacgggtggggagtggccgtgctggtgggcgtcgccggcaaggacgcg
gcgttcaagacgcacccgaccaacttcctcaacgagaggacgctcaggggcacgttcttc
ggcaactacaagcctcgcaccgacctgcccggcgtcgtcgagatgtacatgaacaaggag
ctggagctggagaagttcatcacgcacagcgtgcccttctccgagatcaacacggcgttc
gacctgatgctcagtggggagagcctccgctgcatcatcaggatggaggactag

DBGET integrated database retrieval system