KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350171Help
Entry
4350171           CDS       T01015                                 

Definition
Os11g0242100
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:osa00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:osa00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 950 aa AA seqDB search
MVENGVLEQPKGVSRNRPRAQSNDHPVDPGYLPELTWEHKLSNIGYDLPSFRLTWRETFQ
LAGLGLRLGRHILEETSKGRAAVIDPMKKRIAKSGQGVPLGGIGSGSIGRSYKGEFQRWQ
LFPGTCEERPVLANQFSAFISRKDGRNYSSVLHPGKPDLPKGSNISGIGSWDWNMSGQNS
TYHALYPRSWTIYNGEPDPDVNIVCRQISPIIPHNYQQSSYPVSVFTFTVTNSGNTAADV
TLLFTWANSVGGKSELTGYHSNSPMIEKDGVHGILLHHRTANGQPPVTFAIAAQEKEDIH
ISECPYFIISGSSDAFSAKDMWNYVKENGSFDNLDLTKTSMCSKPGLSIGAAIAASVKLP
PQTTQNVSFALAWACPEVKFSSGKTYHRRYTKFHGTDNDAAASLAHDAILEHNSWERQIE
EWQNPILQDERFPDWYPVTLFNELYYLNAGGTIWTDGLPPIQSLTGIGEKKFSLDMQNGD
ADDANGIIPRNNTASDILNQMASVLERIHASMESNSAIGTTLLQGEENIGQFLYLEGIEY
YMWNTYDVHFYASFSLIMLFPKLQLSIQRDFAAAVLMHDPEKLRMLHDGKWVARKVLGAV
PHDLGLYDPWFKVNAYTLYNTDRWKDLNPKFVLQVYRDVVATGDKSFARAVWPSVYMAMA
YMEQFDRDKDGMIENEDFPDQTYDVWSMAGISAYCGGLWVAALQAASALAHEVGDKASEK
LFWDKYEKAKSVYGKLWNGSYFNYDDGDNIMSASIHADQLAGQWYAKACGLFPIVDKDKA
ESALEKIYSFNVMKFKDGKRGAMNGMWPDGTVDMSAMQSREIWPGVTYALAATMIQEGMV
EKGFKTAEGIYHAAWSPEGLGYSFQTPEAWNNDDEYRSLCYMRPLAIWAIQWALSNPKLH
KQTADIPQDSFPKNQFSYARIAKLLHLPEDESPKSFLRVIYEIVRNRYRS
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggtagagaatggtgttctggagcaaccaaagggggtgtctcgaaataggccacgtgct
cagtcgaatgatcatccagttgatcctggatacctcccagagttgacatgggaacacaag
cttagcaatattggctatgatttgccatccttcagacttacatggagagagacattccag
ttggctggccttggtcttcgtcttggccgacacatccttgaagaaacatcaaaaggacgt
gctgctgtgattgatcccatgaagaagcgcattgcaaaatctggtcagggtgttccactt
ggcggcattggttcaggaagtattggaaggagctacaaaggcgagtttcaacgctggcaa
ttgttcccgggaacttgtgaagagagacctgtactggcaaatcaattttctgcgttcatt
tcccgcaaagatggtagaaactattcctcagtgctgcatcctgggaaaccagatttgcca
aaaggaagtaacatttcaggaattggatcctgggactggaatatgagtggacaaaactct
acgtaccacgctctttaccctaggtcctggacgatatacaatggagaacctgacccagat
gtcaacatagtgtgtcgtcagatttctccaattattccacataattatcaacagagcagc
tatccagtttctgtattcactttcacagtaactaactcaggcaatacggctgctgatgta
actttgctttttacatgggctaactctgttggtgggaaatctgaactaactggatatcac
tccaattcccctatgatagaaaaggatggtgtgcatggcattctgttacatcacagaaca
gctaatggacaaccaccagttacttttgccatagctgcacaagagaaagaagatattcat
atctcggaatgcccttactttataatatctggaagttctgatgcattttcagcaaaagac
atgtggaattatgtgaaagagaatggatcttttgataaccttgatctcaccaaaacatcg
atgtgctcaaaacctggattatcaataggggcagctattgcagcttctgttaagctgcct
ccccagacaacccagaatgtatcatttgcacttgcctgggcttgtcctgaagtgaaattc
tccagtggaaaaacctaccataggcgttatacgaaatttcatggcacggataatgatgca
gcagcaagccttgctcatgatgccattctagaacataattcttgggaaaggcaaattgag
gagtggcagaatcctattttgcaagatgagaggtttcctgactggtacccggtcacactt
ttcaatgagttatactaccttaatgctggaggaactatatggactgatggattgccacca
attcaaagcttgacaggtattggtgaaaagaagttttctctggacatgcaaaatggggac
gctgatgatgccaatgggataatcccacggaataatactgccagcgacatccttaatcaa
atggcatcagtactcgagagaattcatgcatctatggaatcaaattctgccataggaaca
actttacttcagggtgaagagaatattggccaattcctctaccttgagggcattgagtat
tatatgtggaacacatatgatgttcatttctatgcatcattctctctgatcatgctgttt
ccaaaactccagctcagcattcagagagatttcgctgctgctgttttgatgcatgatcct
gaaaagctcaggatgttacatgatggaaaatgggttgcgagaaaagttcttggtgctgtt
cctcatgatcttgggctatatgacccctggttcaaagttaatgcatatacgctctataac
acagatcgatggaaggacttgaacccaaagtttgttctgcaagtttatagagatgtggtt
gccacaggtgacaaatcctttgctcgtgctgtttggccatctgtttatatggcaatggca
tatatggagcaatttgacagggataaagatgggatgattgaaaatgaggactttccagat
cagacttatgatgtgtggtcaatggctggtataagtgcgtactgtggtggactttgggtg
gccgctcttcaagctgcgtcagccttggcacacgaagttggtgacaaagcgtctgaaaaa
cttttctgggacaagtatgagaaggctaagtctgtttatggcaagttgtggaatggttct
tacttcaattatgatgatggcgacaacataatgagtgcatccatccatgcggatcaattg
gctggacaatggtatgccaaagcttgcggtctcttcccaattgttgacaaggataaggcg
gaaagtgcactagaaaagatatattctttcaatgtgatgaaattcaaggatggtaaaagg
ggagcaatgaatgggatgtggccagatggcacagtggacatgtccgcaatgcaatctcgg
gagatatggccaggtgtgacatatgcacttgctgcaaccatgattcaagaaggcatggtt
gagaaggggttcaaaacagctgaggggatttatcatgctgcctggtctccagaaggactt
gggtactcatttcaaacccctgaagcttggaacaatgacgatgaataccgatcgttgtgc
tacatgcgccctcttgcaatatgggccatacagtgggcactatcaaacccaaaactccac
aagcagactgcagatatcccacaggactctttcccaaagaaccagttctcgtatgctcgg
attgcgaagttgctgcatttacctgaagacgaatcgccgaagagtttccttcgagtgatt
tatgagattgttcgtaacaggtataggtcctga

DBGET integrated database retrieval system