KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350498Help
Entry
4350498           CDS       T01015                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 918 aa AA seqDB search
MEMEMEMVVAVPSPEVPAEEERALIRDITVAAEAHAKEGDTFFLITHRWWQSWIDYVIQD
LANSTNNGSHHHEHGSNVLRRPGAIDNTDLIDDTASEVSNMEIELHDTLVEGRDYILLPQ
QVWEKLHGWYGGGPTLPRKAINTGLSQTDLAIEVYPLRLQLLLAPKGEQAVIRISKKDTV
GELHKKACEVFDLIPDEVCIWDYYGRTRHSLMDNLEKTLDDANIQMDQDILVEVTTDANG
SLDGGCIGSIQENEYLERESTSLIADASKSGLSNENFASNNYTSRSYSSSLTQSQYLRSS
NGDLDNMHGTSAMITRGSPLGLTGLLNLGNTCFMNSAIQCLVHTPEFARYFREDYHREIN
WQNPLGMVGELALAFGELLRKLWAPGRTPVSPRPFKTKLSRFAPQFSGYNQHDSQELLAF
LLDGLHEDLNRVKHRPYIKSKDADGRSDDEVADEYWANHIARNNSIIVDVCQGQYKSTLV
CPACGKVSVTFDPFMYLSLPLQFTSTRSMTVMVFTFDGSTPPTPYTVNVPKQGRCRDLIQ
AISNACSLRNGERLVIAEIRNHRIHRLLDDPVVQLSTINDDDHLAVYRLPKMEKKPNYIQ
FVHRRDDWDNGNNISVTAWKPYGVPLLAQVSRNETVTGMHIHEMVRKMLAPMQKNQESQH
SVQSSVSTRTQTYHTDSTKFQLQLIDDSNTTIEQSNDTIRVPQSSLAAVIFVNWSKADLK
KLNTHHLENLPEVFKYAPPAKRTRGEPLSLYSCLDAFLREEPLVPEDMWYCPRCKEQRQA
SKKLDLWRLPEVLVIHLKRFSFSRSTKQKLETFVNFPIHDFDLTNYIANKKSSERQIYEL
YAVSNHYGSMASGHYTAYIKLLDEERWYNFDDSHVSAINEEDVKSGAAYVLFYRRVRGGA
ASNAIHPHVNQNHRSSQR
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagatggagatggtggtggccgtgccgtcgccggaggtgcccgcggaggag
gagagggcgctgatccgggacatcaccgtcgccgccgaggcccacgccaaggaaggggac
accttcttcctcatcacccacaggtggtggcaaagttggattgattatgtcattcaagat
ttggctaattcaacgaataatggttctcatcatcatgagcatggttctaacgttctgaga
agaccaggagcaattgacaatacagatttgatagatgatactgcatctgaagtctcgaat
atggagattgaactacatgatacattggttgagggtcgtgactatatactgcttccccaa
caagtctgggaaaagttgcacggttggtatggtggaggaccaacattgccaagaaaggca
atcaatactggcttgtctcaaactgatttagccatagaagtttatcctttacgtctgcag
ttacttctggctccaaaaggagagcaagctgttataaggataagcaaaaaagatacagtt
ggcgaactccataagaaggcttgtgaggtttttgatttgatacctgatgaggtctgcatt
tgggactactatggccgaacaagacattctttgatggataacttggagaaaacccttgat
gatgccaacattcaaatggatcaagatattctagtggaggttactaccgatgcaaatggt
agtttggatggtggttgcattggttcaatccaagaaaatgaatatttagaacgagaatca
acttccttgattgcagatgcttcgaaatcaggattatcaaatgagaattttgcatcaaac
aattatacttccagaagctacagctctagtcttacacaaagccagtacctgcgatcttcg
aatggggacttagataacatgcatggtactagtgccatgatcaccagaggatctccttta
ggtcttacagggctactcaacttgggaaatacatgtttcatgaatagtgctatacaatgc
cttgtgcacacaccagaattcgctagatattttcgtgaagattaccaccgtgaaataaat
tggcaaaatcccctgggtatggtgggtgaacttgcattagcctttggtgagctactgaga
aaactgtgggctcctggacgtacaccagtttctcctcggccattcaaaacaaagctgtct
cgctttgcacctcagttcagtggatacaaccaacatgattcacaggagttgttggcattc
ctcttggatggacttcatgaagacttgaaccgtgtgaaacataggccttacataaagtcc
aaagacgctgatggtcgatcagatgatgaggttgcagatgaatattgggccaatcatatt
gccagaaacaattcaatcattgttgatgtatgccagggacagtacaagtcaactttggta
tgcccagcctgtggaaaggtttcagtgacttttgacccattcatgtatctttccttgcct
ctacaatttacatcaacccggagcatgaccgttatggtctttacttttgatgggagtact
ccaccaacaccatacactgtaaatgtacccaagcaaggaaggtgcagagatcttatccaa
gccatcagcaatgcatgctcacttagaaatggggagagacttgtaattgccgagatacgt
aatcataggatccatcgtctacttgatgatccagtggttcaactatcaacaattaatgat
gatgatcacttggcagtttataggcttccaaaaatggaaaaaaagccaaattacattcag
tttgttcatcgccgtgatgattgggacaacggaaacaatatcagtgtaacagcttggaag
ccctacggtgttcctcttctggcacaagtatctcgtaatgaaactgtcacgggtatgcat
atccatgagatggtccgtaaaatgcttgcacctatgcagaagaatcaggaatcccaacat
tcggttcaaagctctgtttccacaaggacacagacttatcatactgacagcaccaaattt
cagctacagttgattgacgatagcaacacaactattgagcaatccaatgatactattaga
gttccacagtcttctcttgcagctgtaatctttgtcaattggtctaaagcagatctgaaa
aagttaaacactcatcatttggagaaccttccggaggtgttcaagtatgctcctcctgcc
aagagaacccgtggtgaacctctctcgctttattcatgcttggatgctttcttgagagaa
gaacctcttgttcctgaagacatgtggtactgtccgaggtgcaaggagcaaaggcaagcc
agcaaaaagcttgacttatggagacttccagaagtgctagttatacatttgaagagattc
tcctttagtaggtcaacaaagcagaagcttgaaacatttgtcaacttcccaatacatgat
tttgatttgacaaactatattgccaacaagaagagctcagaacgccagatatatgagttg
tatgctgtgagcaatcattatggcagcatggcaagtggacattatacagcatacataaag
cttttggacgaggaaagatggtataattttgatgatagccatgtttctgccatcaatgaa
gaagatgtaaaatcaggtgcagcctatgtgctcttttacagaagagttagaggtggagca
gcaagcaatgcaattcatccgcacgttaatcaaaatcacagatctagccaaagatga

DBGET integrated database retrieval system