KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350498Help
Entry
4350498           CDS       T01015                                 

Definition
Os11g0473200
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 382 aa AA seqDB search
MEMEMEMVVAVPSPEVPAEEERALIRDITVAAEAHAKEGDTFFLITHRWWQSWIDYVIQD
LANSTNNGSHHHEHGSNVLRRPGAIDNTDLIDDTASEVSNMEIELHDTLVEGRDYILLPQ
QVWEKLHGWYGGGPTLPRKAINTGLSQTDLAIEVYPLRLQLLLAPKGEQAVIRISKKDTV
GELHKKACEVFDLIPDEVCIWDYYGRTRHSLMDNLEKTLDDANIQMDQDILVEVTTDANG
SLDGGCIGSIQENEYLERESTSLIADASKSGLSNENFASNNYTSRSYSSSLTQSQYLRSS
NGDLDNMHGTSAMITRGSPLGLTGLLNLGNTCFMNSAIQCLVHTPEFARYFREDYHREIN
WQNPLGMVVSTLSTSMALKPYV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagatggagatggtggtggccgtgccgtcgccggaggtgcccgcggaggag
gagagggcgctgatccgggacatcaccgtcgccgccgaggcccacgccaaggaaggggac
accttcttcctcatcacccacaggtggtggcaaagttggattgattatgtcattcaagat
ttggctaattcaacgaataatggttctcatcatcatgagcatggttctaacgttctgaga
agaccaggagcaattgacaatacagatttgatagatgatactgcatctgaagtctcgaat
atggagattgaactacatgatacattggttgagggtcgtgactatatactgcttccccaa
caagtctgggaaaagttgcacggttggtatggtggaggaccaacattgccaagaaaggca
atcaatactggcttgtctcaaactgatttagccatagaagtttatcctttacgtctgcag
ttacttctggctccaaaaggagagcaagctgttataaggataagcaaaaaagatacagtt
ggcgaactccataagaaggcttgtgaggtttttgatttgatacctgatgaggtctgcatt
tgggactactatggccgaacaagacattctttgatggataacttggagaaaacccttgat
gatgccaacattcaaatggatcaagatattctagtggaggttactaccgatgcaaatggt
agtttggatggtggttgcattggttcaatccaagaaaatgaatatttagaacgagaatca
acttccttgattgcagatgcttcgaaatcaggattatcaaatgagaattttgcatcaaac
aattatacttccagaagctacagctctagtcttacacaaagccagtacctgcgatcttcg
aatggggacttagataacatgcatggtactagtgccatgatcaccagaggatctccttta
ggtcttacagggctactcaacttgggaaatacatgtttcatgaatagtgctatacaatgc
cttgtgcacacaccagaattcgctagatattttcgtgaagattaccaccgtgaaataaat
tggcaaaatcccctgggtatggtggtaagtactctttctactagcatggcgttgaagcct
tacgtttga

DBGET integrated database retrieval system