KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350498Help
Entry
4350498           CDS       T01015                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 5
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4350498
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   4350498
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    4350498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 918 aa AA seqDB search
MEMEMEMVVAVPSPEVPAEEERALIRDITVAAEAHAKEGDTFFLITHRWWQSWIDYVIQD
LANSTNNGSHHHEHGSNVLRRPGAIDNTDLIDDTASEVSNMEIELHDTLVEGRDYILLPQ
QVWEKLHGWYGGGPTLPRKAINTGLSQTDLAIEVYPLRLQLLLAPKGEQAVIRISKKDTV
GELHKKACEVFDLIPDEVCIWDYYGRTRHSLMDNLEKTLDDANIQMDQDILVEVTTDANG
SLDGGCIGSIQENEYLERESTSLIADASKSGLSNENFASNNYTSRSYSSSLTQSQYLRSS
NGDLDNMHGTSAMITRGSPLGLTGLLNLGNTCFMNSAIQCLVHTPEFARYFREDYHREIN
WQNPLGMVGELALAFGELLRKLWAPGRTPVSPRPFKTKLSRFAPQFSGYNQHDSQELLAF
LLDGLHEDLNRVKHRPYIKSKDADGRSDDEVADEYWANHIARNNSIIVDVCQGQYKSTLV
CPACGKVSVTFDPFMYLSLPLQFTSTRSMTVMVFTFDGSTPPTPYTVNVPKQGRCRDLIQ
AISNACSLRNGERLVIAEIRNHRIHRLLDDPVVQLSTINDDDHLAVYRLPKMEKKPNYIQ
FVHRRDDWDNGNNISVTAWKPYGVPLLAQVSRNETVTGMHIHEMVRKMLAPMQKNQESQH
SVQSSVSTRTQTYHTDSTKFQLQLIDDSNTTIEQSNDTIRVPQSSLAAVIFVNWSKADLK
KLNTHHLENLPEVFKYAPPAKRTRGEPLSLYSCLDAFLREEPLVPEDMWYCPRCKEQRQA
SKKLDLWRLPEVLVIHLKRFSFSRSTKQKLETFVNFPIHDFDLTNYIANKKSSERQIYEL
YAVSNHYGSMASGHYTAYIKLLDEERWYNFDDSHVSAINEEDVKSGAAYVLFYRRVRGGA
ASNAIHPHVNQNHRSSQR
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagatggagatggtggtggccgtgccgtcgccggaggtgcccgcggaggag
gagagggcgctgatccgggacatcaccgtcgccgccgaggcccacgccaaggaaggggac
accttcttcctcatcacccacaggtggtggcaaagttggattgattatgtcattcaagat
ttggctaattcaacgaataatggttctcatcatcatgagcatggttctaacgttctgaga
agaccaggagcaattgacaatacagatttgatagatgatactgcatctgaagtctcgaat
atggagattgaactacatgatacattggttgagggtcgtgactatatactgcttccccaa
caagtctgggaaaagttgcacggttggtatggtggaggaccaacattgccaagaaaggca
atcaatactggcttgtctcaaactgatttagccatagaagtttatcctttacgtctgcag
ttacttctggctccaaaaggagagcaagctgttataaggataagcaaaaaagatacagtt
ggcgaactccataagaaggcttgtgaggtttttgatttgatacctgatgaggtctgcatt
tgggactactatggccgaacaagacattctttgatggataacttggagaaaacccttgat
gatgccaacattcaaatggatcaagatattctagtggaggttactaccgatgcaaatggt
agtttggatggtggttgcattggttcaatccaagaaaatgaatatttagaacgagaatca
acttccttgattgcagatgcttcgaaatcaggattatcaaatgagaattttgcatcaaac
aattatacttccagaagctacagctctagtcttacacaaagccagtacctgcgatcttcg
aatggggacttagataacatgcatggtactagtgccatgatcaccagaggatctccttta
ggtcttacagggctactcaacttgggaaatacatgtttcatgaatagtgctatacaatgc
cttgtgcacacaccagaattcgctagatattttcgtgaagattaccaccgtgaaataaat
tggcaaaatcccctgggtatggtgggtgaacttgcattagcctttggtgagctactgaga
aaactgtgggctcctggacgtacaccagtttctcctcggccattcaaaacaaagctgtct
cgctttgcacctcagttcagtggatacaaccaacatgattcacaggagttgttggcattc
ctcttggatggacttcatgaagacttgaaccgtgtgaaacataggccttacataaagtcc
aaagacgctgatggtcgatcagatgatgaggttgcagatgaatattgggccaatcatatt
gccagaaacaattcaatcattgttgatgtatgccagggacagtacaagtcaactttggta
tgcccagcctgtggaaaggtttcagtgacttttgacccattcatgtatctttccttgcct
ctacaatttacatcaacccggagcatgaccgttatggtctttacttttgatgggagtact
ccaccaacaccatacactgtaaatgtacccaagcaaggaaggtgcagagatcttatccaa
gccatcagcaatgcatgctcacttagaaatggggagagacttgtaattgccgagatacgt
aatcataggatccatcgtctacttgatgatccagtggttcaactatcaacaattaatgat
gatgatcacttggcagtttataggcttccaaaaatggaaaaaaagccaaattacattcag
tttgttcatcgccgtgatgattgggacaacggaaacaatatcagtgtaacagcttggaag
ccctacggtgttcctcttctggcacaagtatctcgtaatgaaactgtcacgggtatgcat
atccatgagatggtccgtaaaatgcttgcacctatgcagaagaatcaggaatcccaacat
tcggttcaaagctctgtttccacaaggacacagacttatcatactgacagcaccaaattt
cagctacagttgattgacgatagcaacacaactattgagcaatccaatgatactattaga
gttccacagtcttctcttgcagctgtaatctttgtcaattggtctaaagcagatctgaaa
aagttaaacactcatcatttggagaaccttccggaggtgttcaagtatgctcctcctgcc
aagagaacccgtggtgaacctctctcgctttattcatgcttggatgctttcttgagagaa
gaacctcttgttcctgaagacatgtggtactgtccgaggtgcaaggagcaaaggcaagcc
agcaaaaagcttgacttatggagacttccagaagtgctagttatacatttgaagagattc
tcctttagtaggtcaacaaagcagaagcttgaaacatttgtcaacttcccaatacatgat
tttgatttgacaaactatattgccaacaagaagagctcagaacgccagatatatgagttg
tatgctgtgagcaatcattatggcagcatggcaagtggacattatacagcatacataaag
cttttggacgaggaaagatggtataattttgatgatagccatgtttctgccatcaatgaa
gaagatgtaaaatcaggtgcagcctatgtgctcttttacagaagagttagaggtggagca
gcaagcaatgcaattcatccgcacgttaatcaaaatcacagatctagccaaagatga

DBGET integrated database retrieval system