KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350527Help
Entry
4350527           CDS       T01015                                 

Definition
Os11g0484400
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:osa00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:osa00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:osa00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 77 aa AA seqDB search
MIYKYFLVDSFLLTIIFFFQFYVESGELSCQMYQRSADMGLGVPFNIASYSLLTYMIAHV
CGMLSSTLLCDWIIPKV
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgatatacaaatattttcttgtagatagtttcttgcttacaataattttcttcttccag
ttttatgttgagagcggggagctatcgtgccagatgtatcaacgctctgctgatatggga
cttggtgttccattcaacattgcatcatattctcttctgacatacatgattgctcatgtt
tgcggtatgttatcttctaccctgctatgtgactggataatcccaaaggtctaa

DBGET integrated database retrieval system