KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350527Help
Entry
4350527           CDS       T01015                                 

Definition
(RefSeq) bifunctional dihydrofolate reductase-thymidylate synthase
  KO
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    4350527
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4350527
   00670 One carbon pool by folate
    4350527
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     4350527
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     4350527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
11
AA seq 582 aa AA seqDB search
MLVAEVFRAGAYISRFSRHACQVARFSGISCAPISQFRRPQSLEGSRKLRSCCFIQTRLI
AMATTLSNGVSQNGPQRNYQVVVAATRDMGIGKDGVLPWKLLGDLKFFKELTVTTADPVK
KNAVIMGRKTWESLPLKARPLPGRLNIILTRSGSFEFATVENVVICGSMNSALELLSSTP
YCLSIEKVFVIGGGQVLRESLNGPSCEAVHLTDIQSSIECDTFIPPIDLSVFQPWYSSLP
VVESNIRHSFVTYVRVRKTMAETHDSNGKESANDGIKSDKFETENFSFLPKLIFDRHEEY
HYLNLVEDIIRSGAQKNDRTGTGTLSKFGCQMRFNLRNSFPLLTTKKVFWRGVVEELLWF
ISGSTSAKVLQEKGIHIWDGNASREYLDSVGLAHREEGDLGPVYGFQWRHFGAEYTDMHA
DYTGKGFDQLMDVIDKIKNNPDDRRIILSAWNPSDLKKMALPPCHMFAQFYVESGELSCQ
MYQRSADMGLGVPFNIASYSLLTYMIAHVCGLSPGEFVHVIGDAHVYRTHVRALEEQIQK
LPKPFPVLKINPLKKDIDSFVASDFKLVGYDPHQKIEMKMAI
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgttagttgcagaggtgttcagagcaggagcatacatctctagattttcgcgacatgca
tgccaagttgcaagattttcgggcattagctgtgcacccatttctcaattcagaagacct
caatctctggagggcagcagaaaactaaggtcttgctgctttattcaaacccgactgata
gccatggctacaactctctccaatggtgtttcacagaatggccctcagaggaactatcag
gtagttgttgctgctactcgcgacatgggcattggaaaggatggggtcttgccatggaag
ctccttggcgaccttaaatttttcaaggagcttacagtgactacagctgatcctgtgaag
aaaaatgctgttataatggggaggaaaacatgggagagtttaccccttaaggctaggcca
ttgcctggccgtttgaacatcatattgactaggtctggtagttttgagtttgcaacagtc
gaaaatgttgttatctgtggaagcatgaactctgcattggaactactatcatcaactcca
tactgtttatccattgagaaagtttttgttatagggggtggacaagtactaagggaatct
cttaatggaccttcatgtgaggcagtccatttaactgacattcagtcaagcattgagtgt
gacacctttattcctccgattgacttatcggtgttccaaccatggtattcatctttgcct
gtggtagagagcaacattaggcattcgtttgtgacctatgttcgggttagaaaaacaatg
gcagaaacacatgactcaaatggcaaggaatcagctaatgatggtatcaagagtgacaaa
tttgaaaccgagaatttctcttttctccctaagttgatatttgaccgccatgaggagtat
cactatctcaatcttgttgaagatattataaggagtggtgctcagaaaaatgacagaaca
ggaacagggacattatcgaaatttggttgtcagatgcggttcaacttaaggaatagcttc
ccattgttgacaacaaagaaggtattttggaggggtgttgttgaagaactcctgtggttc
atcagtggctcgacaagtgcaaaggttttacaagagaaaggcattcatatttgggatggc
aatgcttcgagagagtatcttgacagtgttggcttagcacatagggaagaaggtgatcta
ggtccagtttatggatttcaatggcgacactttggtgctgaatataccgacatgcatgct
gactatactggtaaaggctttgatcagctaatggatgtgattgacaagatcaagaataat
cctgacgataggcgaattatcctatctgcgtggaatccttcagatctcaagaagatggcc
cttcctccttgccacatgtttgcacaattttatgttgagagcggggagctatcgtgccag
atgtatcaacgctctgctgatatgggacttggtgttccattcaacattgcatcatattct
cttctgacatacatgattgctcatgtttgcggtctttctcctggagagtttgtccatgtt
attggtgatgcccatgtctatagaacacatgtgcgagctctggaggagcaaatccagaag
ctacctaaaccatttccagttttgaagattaaccctttgaagaaggatatagattctttc
gtggcatcagacttcaagctggtcggttatgatcctcaccagaagattgaaatgaaaatg
gcaatataa

DBGET integrated database retrieval system