KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350636Help
Entry
4350636           CDS       T01015                                 

Definition
Os11g0530600
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    4350636
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    4350636
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     4350636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 398 aa AA seqDB search
MAAAVTVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITKSEHMVELKEKFK
RMCDKSQIRKRYMHLTEEILQENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEW
GQPRSRITHLVFCTTSGVDMPGADYQLAKMLGLRPNVNRLMMYQQGCFAGGTVLRVAKDL
AENNRGARVLAVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGSDPDEAVERPLF
QMVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALGDAFTPLGISDWNS
IFWVAHPGGPAILDQVEAKVGLDKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDG
HATTGEGMDWGVLFGFGPGLTVETVVLHSVPITAGAAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggtgacggtggaggaggtgaggagggcgcagagggcggaggggccggcg
acggtgctggcgatcgggacggcgacgccggcgaactgcgtgtaccaggccgactacccg
gactactacttcaggatcaccaagagcgagcacatggtcgagctcaaggagaagttcaag
aggatgtgtgacaagtcgcagatcaggaagaggtacatgcacctgacggaggagatcctg
caggagaaccccaacatgtgcgcgtacatggcgccgtcgctggacgcgcggcaggacatc
gtcgtcgtcgaggtccccaagctggggaaggcggcggcgcagaaggcgatcaaggagtgg
gggcagccgcgctcccgcatcacccacctcgtcttctgcaccacctccggcgtcgacatg
cccggcgccgactaccagctcgccaagatgctcggcctgaggcccaacgtgaaccgcctc
atgatgtaccagcaggggtgcttcgccggcggcacggtgctccgcgtcgccaaggacctc
gccgagaacaaccgcggcgcgcgcgtcctcgccgtgtgctccgagatcacggcggtgacg
ttccgggggccctccgagtcccacctcgactccatggtcgggcaggcgctgttcggcgac
ggcgcggcggcggtgatcgtcggctccgaccccgacgaggccgtcgagcggccgctgttc
cagatggtgtcggcgagccagaccatcctcccggacagcgagggcgccatcgacggccac
ctgagggaggtcgggctgacgttccacctgctcaaggacgtgccggggctcatctcgaag
aacatcgagcgcgcgctgggcgacgcgttcacaccgctggggatctcggactggaactcc
atcttctgggtggcgcaccccggaggtccggcgatcctggaccaggtggaggcgaaggtt
gggctggacaaggagaggatgagggcgacgcgccacgtgctgtccgagtacggcaacatg
tcgagcgcctgcgtgctcttcatcctcgacgagatgcgcaagcgctccgccgaggacggc
cacgccaccaccggcgagggcatggactggggcgtcctcttcggcttcggccccggcctc
accgttgagaccgtcgtcctccacagcgtccccatcaccgccggcgccgccgcctga

DBGET integrated database retrieval system