KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351289Help
Entry
4351289           CDS       T01015                                 

Definition
Os12g0110000
Orthology
K07204  
regulatory associated protein of mTOR
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 1242 aa AA seqDB search
ISVDPPDVIKISPCARKECWIDPFSMAPPKALETIGKTLHSQYERWQPKARYKLQLDPTL
EEVKKLCNTCRKFARTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPITDLDSWLK
TPSIYVFDCSAAGMIVKAFLERLDWSSSSSASSSKDCILLAACEAHQTLPQSAEFPADVF
TACLTTPIKMALHWFCNRSLLRDSMEHNLIDQIPGRQNDRKTLLGELNWIFTAITDTIAW
NVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPISYPLLPPTHQHHMWDAWDMA
AEICLSKLPQLIADPNAEFQPSPFFTEQLTAFEVWLDHGSEDKKPPEQLPIVLQVLLSQS
HRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTSAMELRQILVFIWTKILSLDKS
CQVDLVKDGGHAYFIRFLDSLDAYPEQRAMAAFVLAVIVDGHRIGQEACANAGLIDVCLR
HLQPENPNDAQTEPLLLQWLCLCLGKLWEDFPEAQLLGLQSNAPEIVICLLSEPQPEVRA
SAVFALGNLVDIGSPSLNGADDDSDDDEKVRAEINVVRSLLQISSDGSPLVRSEVAVALT
RFAMGHNKHIKSVAAEYWKPQTNSLLKSLPSLANINSSNVYSPSSLIQGSSGLASHIGPV
LRVGSDNSATARDGRISTSSPIATNSIMHGSPQSDDSSQHSDSGILLRENASNGGLNYSR
SRPIDNGIYSQFIATMCNVAKDPYPRIASIGKRALSLIGVEQVSMRNSRLSNGGAHPGET
SVPPSSNFGMARSSSWFDMNSGNFSVAFRTPPVSPPQHDYLTGLRRVCSMEFRPHVLNSP
DGLADPLLSSSAAPSNMGLYILPQSLIYRWSCGHFSRPLLTGSDDNEEANARREERERIA
MDCIAKCQRSSCKMTSQIASWDTRFELGTKASLLLPFSPIVVAADENEQIRVWNYDDALP
VNTFENHKLSDRGLSKLLLINELDDSLLLVGSSDGNVRIWRNYTQKGGQKLVTAFSSVQG
YRSAGRSIVFDWQQQSGYLYASGDMSSILVWDLDKEQVNTIQSTADSGISALSASQVRCG
QFAAGFLDASVRIFDVRTPDRLVYTARPHAPRSEKVVGIGFQPGFDPYKIVSASQAGDIQ
FLDVRRASEPYLTIEAHRGSLTALAVHRHAPVIASGSAKQMIKVFSLEGEQLTIIRYQPS
FMGQRIGSVNCLSFHRYKSLLAAGAGDNALVSIYAEDNYQVR
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
attagtgttgatccgccggatgtgatcaaaatctccccttgtgcaagaaaggagtgctgg
atagatccattttctatggcacctccaaaagcccttgaaactattgggaaaacattacac
tcacaatatgagcgctggcagccaaaggctcgttacaagcttcagctggatccgacatta
gaggaagttaagaagctatgtaatacttgccgtaaatttgctagaacagagagagtcctt
tttcattacaatggtcatggtgtaccaaagcctacagctaatggggagatttgggtattt
aacaagagttacacacagtatattccgcttcctattactgatcttgattcatggctgaaa
acaccctctatatatgtttttgactgctcagcagctggaatgatcgtgaaagcttttctg
gagcgcctagactggagttctagctcgtctgcatcttcatcgaaggactgcattctcctt
gcggcctgtgaggcacatcaaactctcccacagagcgcagaatttcctgctgatgtgttc
acagcttgcctcaccacacccatcaaaatggcactgcactggttttgtaaccgatcgtta
ctccgtgattccatggaacacaatcttatcgaccaaattcctggaaggcaaaatgaccgc
aaaactcttctaggggagttgaactggattttcactgctatcacagacactattgcatgg
aatgttcttcctcatgatctattccaaagacttttcaggcaggatcttttggttgctagt
ctctttcgcaacttcttacttgctgagagaatcatgcggtccgcaaattgttccccaatt
tcataccctttgttgccaccaactcatcagcaccatatgtgggatgcatgggacatggct
gcagagatctgcctttctaagcttcctcaattaattgctgatcctaatgcagagtttcag
ccgagtccatttttcacggagcaattgacagcatttgaagtttggcttgatcatggctct
gaagacaagaaacccccagaacagctacctattgttcttcaggttttgcttagtcagtca
cacagatttagagcacttgttctgcttggaagatttcttgacatgggaccttgggcagtt
gatttggctttgtccgttggcatcttcccttatgtacttaaactgcttcaaacaagtgca
atggagttgcgccaaattcttgtgttcatatggacaaaaattctctctcttgataagtca
tgccaggttgacttggtgaaagatggagggcatgcatactttatcaggtttcttgacagt
ttggatgcttacccagagcagcgtgcaatggctgctttcgttttagccgttattgtggat
gggcataggattggtcaagaggcttgtgctaatgcagggcttatagatgtctgcctgaga
catctgcaacctgaaaatccgaatgatgctcagacagagcctttgctcttgcaatggctt
tgtttatgccttggcaaactttgggaagatttccctgaggctcagttacttggtctgcaa
tcaaacgcaccggaaattgttatatgcttattgtcagagcctcaacctgaagtcagagct
tctgctgtttttgcacttggaaatcttgtggatattggatctccatcactgaatggagct
gacgacgattctgatgatgatgaaaaggtgagagctgaaataaatgttgtccgaagcctt
ctgcagatctcttcagatggtagccctcttgttagatctgaggttgccgtagcgcttacc
cgctttgcaatggggcacaataaacatatcaaatctgttgccgccgagtactggaaacct
caaaccaattcactgctcaagtcattaccatcgttggctaatattaattcgagcaatgtt
tacagtcccagcagcttaatacaaggtagcagtggccttgcctcacatattggtcctgtt
ttaagggttggcagtgataacagtgccactgctcgtgatggaagaatctctacgagcagc
ccgattgcaacaaatagcatcatgcatggttctccacagtcagatgattcttcccaacac
tctgattcaggcatattactgagagagaatgcaagtaatggtggtctcaactactcaaga
tcgaggcctattgataatgggatctattcccaatttatagcaactatgtgcaatgttgct
aaagatccttacccaagaattgcaagtattgggaaaagggcattgtccctcataggtgtt
gagcaagtaagcatgagaaacagtagacttagcaatggaggtgcacacccaggagagaca
tctgtgcccccttcatcaaactttggaatggcacgctcctcttcctggtttgatatgaac
tctggaaatttctcggtggcctttaggactcctcctgttagtccccctcagcatgactac
ctcacaggattgcgccgagtgtgctcgatggagttcagaccacatgttttgaactcacct
gatggcttagctgatccgcttttaagctccagtgcagcccccagcaacatggggctctat
atacttccccaatcattaatttacagatggagttgtggtcacttttctaggccacttcta
actggttctgatgataacgaggaagcaaatgctagaagagaagagcgagaacgaattgca
atggattgcattgctaaatgccaacgatcatcttgcaagatgaccagccaaattgctagc
tgggatacgaggtttgagttgggtacaaaagcatcattgttgttgccattttctcctatt
gttgttgctgcggatgaaaatgagcaaatacgagtatggaactatgacgatgcgctgcca
gtgaatacttttgaaaaccacaagttatctgacagaggcctatctaaacttttgctgatc
aatgagcttgatgatagcttgttgttagttggctcaagtgatggaaatgtccgcatatgg
agaaactatactcaaaagggaggacaaaaacttgtaactgctttttcatcagttcaaggc
tatcgaagtgctggtcgcagtattgtatttgattggcagcaacagtcgggttatctgtat
gcatctggtgacatgtcctctatccttgtatgggatcttgacaaggaacaagtcaacacc
atccagtcaactgctgatagcgggatttcagctctttctgcatctcaggttcgatgtggc
caattcgctgctggttttcttgatgcatctgttaggatatttgacgtgcgtacacctgat
aggctagtatatacagcaagaccacatgccccaagatcagaaaaggttgttggtatagga
tttcagcctgggtttgatccctacaagattgtaagtgcatctcaagctggagacattcag
ttccttgatgttagaagggcatctgaaccctacctcactattgaagcacataggggttca
ttaacggcattagctgttcatcggcatgccccagttattgcaagcggctcagccaagcag
atgatcaaagtgtttagtcttgaaggagaacagttgacaataattcgctaccagccatct
tttatgggtcaacgaataggcagcgtaaactgcctttctttccaccgatacaaatcactc
cttgccgctggtgctggtgataatgctcttgtttctatctacgcggaggacaattaccaa
gtacgatga

DBGET integrated database retrieval system