KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351685Help
Entry
4351685           CDS       T01015                                 

Definition
Os12g0183200
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4351685
  Energy metabolism
   00920 Sulfur metabolism
    4351685
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    4351685
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     4351685
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     4351685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 360 aa AA seqDB search
MSELPSPPPPAAGNQYGAEHAAAKKAVALAARLCKKVQQDLLKLDVQTKADRTPVTVADY
GSQVLVSVVLKIELPSNSFSMVAEEDSEDLRKDGAQEMLGHITKLVNETIINDGSYSITL
SKEDVLVAIDGGKSEGGPSGRYWILDPIDGTKGFIRGDQYAIGLALLDEGKVVLGAMACP
NLPFKSIDHNGGSSGDQVGALFSATIGCGSTVESLEGSQPQKISVCSISNPVDASFFESY
ERKHCMRDCTSSIAEKLGIQAPPVRIDSQAKYGAVAQGDGAIYWRFPHKRSKEAVWDHAA
GSIIVTEAGGLVKDASGNDLDFSKGRYLDRDAGIIATNKYLMPLVVKAAQEAMKEEGILG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagctgccatcgccgccgccgccggccgccggcaaccagtacggagcggagcac
gccgccgccaagaaggccgtcgccctcgccgcccgcctctgcaagaaagtgcagcaggac
ctcttgaaattggacgttcaaactaaggctgacagaacaccggtgacagtcgccgattat
ggatcacaggtattggtaagtgtggtcctgaagattgaattaccttctaactccttttcc
atggtggctgaagaggattctgaagacttgaggaaagatggagctcaagaaatgttggga
catatcaccaaacttgtgaacgaaaccatcataaatgatggttcgtacagcatcacatta
tctaaggaagatgtgctggtagcaatcgatggtggaaaatctgagggtggaccttctggg
cgatattggatattggatccgatagatggaactaagggtttcataaggggagaccaatat
gcaattggacttgcattactggacgaaggcaaagtagttttgggagcaatggcatgccca
aatcttcctttcaaatcaatagatcacaatggtggatcttcgggagatcaagttggtgcc
ctcttttctgctacaattggctgtggatctacagttgagtccttagaaggctctcagcca
caaaagatcagtgtctgttctatcagcaatccagtggatgcctcattctttgaatcttat
gaaagaaaacactgcatgcgtgattgcacttcctccattgcagagaaacttggtattcaa
gctcctccagttagaattgatagccaagcaaaatatggtgctgtagcccaaggtgatggc
gccatttattggcgatttccacacaaacgttccaaagaagcagtatgggatcatgcagct
gggtctattattgtcacagaagctggaggtttggtaaaagatgcttcaggaaacgatttg
gatttctccaaaggtagatatcttgatcgtgatgctggcattattgcaacaaataaatat
ttgatgccattagttgtaaaagctgcccaagaggctatgaaggaggaaggaatactaggc
tga

DBGET integrated database retrieval system