KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351929Help
Entry
4351929           CDS       T01015                                 

Definition
Os12g0264500
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:osa01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:osa00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:osa00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:osa00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 489 aa AA seqDB search
TARFLLPRSPVSIEEVEAAPDANGGGEEANRPRVEGDGEGVLQSNESSAKVDEPVATENS
DAAPAEASVDAVNGKIPPTKLIPQHPLEGVTLTERTVRITGNKKQIEAAKDIIKQAMSQV
LVEANGVTRTLVLNRPKQLNALSSAMITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAGGD
VAAVVRSINNDSWKYGAHFFRNEFLLNYIIATYSKPQVSLLTGIVMGGGAGVSIHGRFRV
VTDSTVFAMPETALGLFPDIGASYFLSRLLGFYGEYVGLTGVRLDAAEMLACGLATHFVP
SDRLSLLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIINKCFSKKTVEEII
ASLEQEAPNVADEWIASAIQSMRKASPTSMKISLRSIREGRTQTVGECLRREYRMVCHVM
RGDFSRDFFEGCRAILLDRDRNPKWMPPRLEEVHDEVVEKYFSKVDDPEWEDLDLPPRRS
HGRRLVPKL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
acggcaagattcctcctaccaagatctccggtgagcatcgaggaggtagaggccgccccc
gacgccaacggcggcggcgaggaagccaatcggccccgcgtggaaggcgacggcgaaggt
gtcttgcagagcaacgagtcctccgcgaaggtcgatgagccggtagctacagagaacagt
gacgctgctcctgctgaggcatctgtagatgctgtgaacggcaagattcctcctaccaag
ttgattccccaacatcctctggaaggtgttacattgacagaaagaactgtacgtattact
gggaataagaagcagatagaagcggcaaaagatattattaagcaagctatgagtcaggtt
ttggtagaagcaaatggtgtaacacggacattggttttgaataggccaaagcagttgaat
gccctctcctctgcaatgataacgtgttttttgaggtgcttcactgcttatgaggaagat
gatggagttaaactattgattgtgaagggaaaaggaagagcattttgtgcaggtggagat
gttgctgcagttgtccggtctataaataatgatagctggaaatatggtgctcattttttc
cgaaatgaatttctgttaaactatatcattgcaacatatagcaaacctcaggtttcgctt
ctaactggaattgtcatgggtggaggtgctggtgtttctatacatggaaggttccgagtt
gtcacagatagcacggtttttgctatgccagaaacagcgttgggtctctttccagatatt
ggggcttcatattttctatctcgacttcttgggttctatggagagtatgttggtcttact
ggtgtaaggttggatgctgctgaaatgcttgcttgtggcctagcaactcattttgtacct
tcagataggctgtctttgctagaagaatcacttaaaaaggttgatacatctgatccattt
gctatatgtggaattatcgatcaatattcgcaacaaccatctctgaaagaaaaaagcgct
ctgaataggctagaaatcatcaacaaatgcttttccaaaaaaacagtagaagaaatcata
gcctctcttgaacaagaggctccaaatgttgctgatgaatggattgcttctgcaatccag
tccatgaggaaggcttctcctactagtatgaaaatatccttgagatcgataagagaaggg
cgaacacaaactgttggtgaatgcttacgtcgagaatatagaatggtttgccatgtgatg
cgtggtgacttcagtagagacttctttgagggatgcagggctatattgttggatagagat
cgaaacccaaagtggatgcctccaaggttggaagaggtgcacgacgaggtggtcgaaaaa
tatttttccaaagtcgatgatccagagtgggaagatttggacctacctcctagacgttcc
catggaaggaggcttgttcccaagctttga

DBGET integrated database retrieval system