KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351929Help
Entry
4351929           CDS       T01015                                 

Definition
Os12g0264500
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4351929
  Carbohydrate metabolism
   00640 Propanoate metabolism
    4351929
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4351929
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4351929
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     4351929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 489 aa AA seqDB search
TARFLLPRSPVSIEEVEAAPDANGGGEEANRPRVEGDGEGVLQSNESSAKVDEPVATENS
DAAPAEASVDAVNGKIPPTKLIPQHPLEGVTLTERTVRITGNKKQIEAAKDIIKQAMSQV
LVEANGVTRTLVLNRPKQLNALSSAMITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAGGD
VAAVVRSINNDSWKYGAHFFRNEFLLNYIIATYSKPQVSLLTGIVMGGGAGVSIHGRFRV
VTDSTVFAMPETALGLFPDIGASYFLSRLLGFYGEYVGLTGVRLDAAEMLACGLATHFVP
SDRLSLLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIINKCFSKKTVEEII
ASLEQEAPNVADEWIASAIQSMRKASPTSMKISLRSIREGRTQTVGECLRREYRMVCHVM
RGDFSRDFFEGCRAILLDRDRNPKWMPPRLEEVHDEVVEKYFSKVDDPEWEDLDLPPRRS
HGRRLVPKL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
acggcaagattcctcctaccaagatctccggtgagcatcgaggaggtagaggccgccccc
gacgccaacggcggcggcgaggaagccaatcggccccgcgtggaaggcgacggcgaaggt
gtcttgcagagcaacgagtcctccgcgaaggtcgatgagccggtagctacagagaacagt
gacgctgctcctgctgaggcatctgtagatgctgtgaacggcaagattcctcctaccaag
ttgattccccaacatcctctggaaggtgttacattgacagaaagaactgtacgtattact
gggaataagaagcagatagaagcggcaaaagatattattaagcaagctatgagtcaggtt
ttggtagaagcaaatggtgtaacacggacattggttttgaataggccaaagcagttgaat
gccctctcctctgcaatgataacgtgttttttgaggtgcttcactgcttatgaggaagat
gatggagttaaactattgattgtgaagggaaaaggaagagcattttgtgcaggtggagat
gttgctgcagttgtccggtctataaataatgatagctggaaatatggtgctcattttttc
cgaaatgaatttctgttaaactatatcattgcaacatatagcaaacctcaggtttcgctt
ctaactggaattgtcatgggtggaggtgctggtgtttctatacatggaaggttccgagtt
gtcacagatagcacggtttttgctatgccagaaacagcgttgggtctctttccagatatt
ggggcttcatattttctatctcgacttcttgggttctatggagagtatgttggtcttact
ggtgtaaggttggatgctgctgaaatgcttgcttgtggcctagcaactcattttgtacct
tcagataggctgtctttgctagaagaatcacttaaaaaggttgatacatctgatccattt
gctatatgtggaattatcgatcaatattcgcaacaaccatctctgaaagaaaaaagcgct
ctgaataggctagaaatcatcaacaaatgcttttccaaaaaaacagtagaagaaatcata
gcctctcttgaacaagaggctccaaatgttgctgatgaatggattgcttctgcaatccag
tccatgaggaaggcttctcctactagtatgaaaatatccttgagatcgataagagaaggg
cgaacacaaactgttggtgaatgcttacgtcgagaatatagaatggtttgccatgtgatg
cgtggtgacttcagtagagacttctttgagggatgcagggctatattgttggatagagat
cgaaacccaaagtggatgcctccaaggttggaagaggtgcacgacgaggtggtcgaaaaa
tatttttccaaagtcgatgatccagagtgggaagatttggacctacctcctagacgttcc
catggaaggaggcttgttcccaagctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system