KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352182Help
Entry
4352182           CDS       T01015                                 

Definition
Os12g0460800
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     4352182
Protein kinases [BR:osa01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   4352182
Spliceosome [BR:osa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    4352182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 192 aa AA seqDB search
IQVSSRSPKEGSYFKQLPKSSAIKVIDFGSTTYDQQDQTYVVSTRHYRAPEVILGLGWSY
PCDIWSVGCILVELCTGEALFQTHENLEHLAMMERVFGPLPCHMLKRADRHSEKYVRKGR
LNWPEGCASRDSMKAVMKLPRLQNLVMQNVDHSGGEFIDLLQGLLRYDPASRLTAQEALR
HPFLREQSERRR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atccaggtttcatcccgttctccaaaggaaggttcctatttcaagcagctgcccaagtcc
agtgctattaaggtgattgattttggcagcacaacatatgaccagcaggatcagacctat
gtggtgtctactaggcattatcgagctccagaagttatcttgggacttggatggagttac
ccctgtgatatatggagtgttggttgtatactggttgagctatgcacgggagaagcattg
tttcagacccatgaaaacttggagcatcttgctatgatggagagggtatttggtcctttg
ccatgtcacatgctcaaaagggcagaccggcattccgagaaatatgtcagaaaaggccgt
ttaaactggcctgaaggttgtgcgtcacgggatagcatgaaagctgttatgaagctgcca
cgtcttcagaatctggtgatgcaaaatgtagatcattctgggggcgagttcattgacctt
ttgcaaggtctgttaaggtatgatccagctagccgcctaacagcacaagaggcgcttagg
catccattcttgagggagcagtccgagcgaagaagatga

DBGET integrated database retrieval system