KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352701Help
Entry
4352701           CDS       T01015                                 

Definition
Os12g0597000
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Protein phosphatases and associated proteins [BR:osa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     4352701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 225 aa AA seqDB search
MVQCLDGVRQLLAVVFKCCDLELKQPRGLEDPQVLARETVFSVSEVEALYELFKKISSAV
IDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILGFDEFARALSVFHPSAPLD
EKIDFSFQLYDLKQQGYIERQEVKQMVVATLAESGMNLSDEIIESIIDKTFEEADTKHDG
RIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagtgtctcgacggggtgaggcagctgctggcggtcgtgttcaagtgctgcgac
ctcgagctgaagcagccgcgggggctcgaggatccccaggtcctcgcgagggagaccgtc
ttcagcgtgagcgaggtcgaggcgctgtacgagctcttcaagaagataagcagtgctgtg
attgatgacgggctgattaacaaggaggagtttcagttggcgctgttcaagaccagcaag
aaggagagcctgttcgccgaccgtgtatttgatttgtttgacacaaaacacaatggaatt
ttaggatttgatgaatttgctcgtgcactctcagtatttcatccaagtgctccacttgat
gagaagattgacttttcattccagttatatgatctcaagcaacaaggctatattgagaga
caagaggttaagcagatggttgttgctacacttgctgagtctggaatgaatctttctgat
gaaattatagagagcataatcgataagacatttgaggaggcagacacaaagcatgatgga
agaattgataaagaagagtggcgcaatctggttcttcgtcatccctctttgctgaagaac
atgactctccagtacctcaaggacatcaccactacatttccaagctttgtcttccattcc
caggtcgatgacacctga

DBGET integrated database retrieval system