KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352817Help
Entry
4352817           CDS       T01015                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
12
AA seq 889 aa AA seqDB search
MPATPDDDPPAAASEAPSTSSAAADEDDRVFLVLHRWWREAQEGGGIEAAGVPYAAAPSG
PTSYGIGMKVLSMFISDQAFTLRRADDLLQPDASASNAASSRTYALVAADLFSKARAWHI
DSGKNAGKKSLSIEEGSVNIYPIMLRVSVTRDTNALTVKISKKDNSAENFKRANKILTSD
SEPVHIWDFSGRTTFILMNEWNRMPQDTRSSDQEMPLEIHFYDLSEPTANGTNGKKDELA
LTMSRSMSNGSIMGMDLDSSGSSKQVGTGLIGLDNLGNTCFMNSAVQCLAHTSKLVDYFL
GDFYKEINHNNPLGLKGELAYSFGDLLRKLWALDRTPVAPRQFKGKLARFAPQFSGFNQH
DSQELLAFLLDGLHEDLNRVKCKPYSEAKDSDGRPDEEVADEYWGNHIARNDSIIVDICQ
GQYKSTLVCPDCRKVSVTFDPFMYLSLPLPSTTMRTMTITVFNTDGTTGPSPYTVSVPKS
GDTKTLIDALSIACSLKGDERLLVAEVYNSALIRYLEEPSEVISLIRDGDRLVAYKLPKD
SEDAPIVVFRNQRMESTLTSFGRKSWKSFGTPLVSSLPDTINGSTIFELYQKVMTPFRVP
KDDSSGADHIIGKSSPVEETTDVDMNSDATESTSINNNDCDDETMTEDGMQFYFINERFP
DQRMKIEMDQPIRLTASQKRLHVVVCWQDNGLEQYNFSSLDNLPEIYKAVLFSRRPQETC
SLYACLEAFIKEEPLGPEDMWYCPGCKEHRQASKKLDLWRLPEILIIHLKRFSYSRYTKN
KLETCVDFPVHDLDLSKYIGSRGQQISNHYRLYAISNHYGSMGGGHYTAYVYHEGKKGWY
DFDDRHVGPISEESIKTSAAYVLFYRRIQGDDNRLDDTETGIDSSDCTT
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgacccccgacgacgacccaccggcggcggcgagcgaagccccgtcgacctcc
tccgcggcggcggatgaggacgaccgcgtcttcctcgtcctccacaggtggtggagggag
gcgcaggaagggggagggatcgaggcggccggggtgccgtacgccgcggcgccgtcgggc
ccgacctcctacggcatcggcatgaaggtgctcagcatgttcatctccgaccaggccttc
accctccgccgcgccgacgacctcctccagcccgacgcctccgcctccaacgcggcctcc
tccaggacctacgccctcgtcgccgccgacctcttctccaaggcgcgcgcctggcatatt
gattctggcaagaatgcggggaaaaaatcattgtctatcgaagaaggatctgtaaacatt
taccctataatgctcagagtttcagtcacgcgagatacaaatgcactaaccgtgaagatc
agcaaaaaggataattctgctgagaactttaaacgggcaaacaagattttgacttcagac
tctgagccggttcatatatgggatttctctggacgaacaacttttatattgatgaacgaa
tggaatcgaatgccccaagacactcggtcttctgatcaggagatgcctctagaaatacac
ttctatgatctgtcagaacctacggcaaatggtaccaatgggaaaaaagatgagttagca
ttaacaatgagtcgttcaatgagcaacggcagcatcatgggcatggatctggattcaagt
ggaagctctaagcaagttggcactggtttaataggactagacaatcttggaaacacatgt
ttcatgaacagtgcagtgcagtgcttagctcatacatccaagctggttgactacttcctt
ggagacttctataaagaaataaaccataataacccactggggttgaagggtgagcttgcg
tattcatttggggatttgttgaggaagctatgggctctggacaggacccctgttgcgcct
cgccaatttaaaggaaagcttgcgcgctttgccccccagttcagtggctttaatcaacat
gattcccaggagcttctggctttcttgttggatggactccatgaggacttgaatcgagtg
aaatgtaaaccatattctgaagcaaaggattcagatggccgtccagatgaagaggtcgca
gatgagtactggggaaaccatatagcccggaatgattctatcatagttgatatctgccag
ggtcaatacaagtcgacgttagtttgccctgattgcaggaaagtatctgtaacatttgac
ccattcatgtacctgtctttgcccctgccttcaacaactatgagaacaatgactataaca
gtcttcaataccgatgggactactgggccatctccgtatactgtgagtgtaccgaaatct
ggagatacaaagactcttatcgatgcattaagcattgcttgttccttgaaaggcgacgag
cgccttttggttgctgaggtctacaatagtgcacttatccggtacttggaggaaccttct
gaagtcatctccttgatcagagatggagatcgcttggttgcatataaacttccaaaagac
agtgaagatgctccaatagtggtgttcagaaaccaacggatggagtccaccctcactagt
tttggcagaaaatcctggaagtcttttggtacaccccttgtgtcaagtcttcctgacaca
atcaatgggagtacgatctttgagctttaccaaaaggttatgactccattccgagtacca
aaagatgatagttcaggtgctgaccacataattggcaaaagcagtcctgtggaggaaacc
acggacgttgatatgaactctgatgcaacagagtcaaccagcataaacaataacgattgt
gacgatgaaacaatgactgaagatggaatgcaattttactttatcaatgagaggtttcca
gaccaacgcatgaagatagaaatggaccaacctattagacttactgcttcacagaagcga
ctgcatgtggttgtgtgttggcaggacaatggactagagcaatacaattttagttcttta
gataatcttccagagatctacaaggctgtcctattctcaaggagaccacaggagacatgt
tctctatatgcatgccttgaagcttttataaaggaggaaccgttaggcccagaagacatg
tggtattgcccaggctgtaaagagcatcgccaagctagtaagaagttagacctttggagg
ctaccggaaatccttataatacacctgaaaagattttcatacagtcgatataccaaaaac
aagctagagacatgtgtggacttcccggttcatgatcttgacctttcaaagtatatcggt
agcagggggcaacagatttccaaccactatcgactgtatgctattagtaatcactatgga
agcatgggaggtggtcactatactgcatatgtttatcatgaaggtaagaaagggtggtat
gactttgatgaccgtcatgtgggtcctataagcgaggagagtataaagacatcggcagct
tatgttcttttttataggcggatacagggggatgataataggttagatgatacagaaaca
ggaatagattcttctgattgtacaacatga

DBGET integrated database retrieval system