KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352817Help
Entry
4352817           CDS       T01015                                 

Definition
Os12g0621000
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 864 aa AA seqDB search
MPATPDDDPPAAASEAPSTSSAAADEDDRVFLVLHRWWREAQEGGGIEAAGVPYAAAPSG
PTSYGIGMKVLSMFISDQAFTLRRADDLLQPDASASNAASSRTYALVAADLFSKARAWHI
DSGKNAGKKSLSIEEGSVNIYPIMLRVSVTRDTNALTVKISKKDNSAENFKRANKILTSD
SEPVHIWDFSGRTTFILMNEWNRMPQDTRSSDQEMPLEIHFYDLSEPTANGTNGKKDELA
LTMSRSMSNGSIMGMDLDSSGSSKQVGTGLIGLDNLGNTCFMNSAVQCLAHTSKLGELAY
SFGDLLRKLWALDRTPVAPRQFKGKLARFAPQFSGFNQHDSQELLAFLLDGLHEDLNRVK
CKPYSEAKDSDGRPDEEVADEYWGNHIARNDSIIVDICQGQYKSTLVCPDCRKVSVTFDP
FMYLSLPLPSTTMRTMTITVFNTDGTTGPSPYTVSVPKSGDTKTLIDALSIACSLKGDER
LLVAEVYNSALIRYLEEPSEVISLIRDGDRLVAYKLPKDSEDAPIVVFRNQRMESTLTSF
GRKSWKSFGTPLVSSLPDTINGSTIFELYQKVMTPFRVPKDDSSGADHIIGKSSPVEETT
DVDMNSDATESTSINNNDCDDETMTEDGMQFYFINERFPDQRMKIEMDQPIRLTASQKRL
HVVDNGLEQYNFSSLDNLPEIYKAVLFSRRPQETCSLYACLEAFIKEEPLGPEDMWYCPG
CKEHRQASKKLDLWRLPEILIIHLKRFSYSRYTKNKLETCVDFPVHDLDLSKYIGSRGQQ
ISNHYRLYAISNHYGSMGGGHYTAYVYHEGKKGWYDFDDRHVGPISEESIKTSAAYVLFY
RRIQGDDNRLDDTETGIDSSDCTT
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgacccccgacgacgacccaccggcggcggcgagcgaagccccgtcgacctcc
tccgcggcggcggatgaggacgaccgcgtcttcctcgtcctccacaggtggtggagggag
gcgcaggaagggggagggatcgaggcggccggggtgccgtacgccgcggcgccgtcgggc
ccgacctcctacggcatcggcatgaaggtgctcagcatgttcatctccgaccaggccttc
accctccgccgcgccgacgacctcctccagcccgacgcctccgcctccaacgcggcctcc
tccaggacctacgccctcgtcgccgccgacctcttctccaaggcgcgcgcctggcatatt
gattctggcaagaatgcggggaaaaaatcattgtctatcgaagaaggatctgtaaacatt
taccctataatgctcagagtttcagtcacgcgagatacaaatgcactaaccgtgaagatc
agcaaaaaggataattctgctgagaactttaaacgggcaaacaagattttgacttcagac
tctgagccggttcatatatgggatttctctggacgaacaacttttatattgatgaacgaa
tggaatcgaatgccccaagacactcggtcttctgatcaggagatgcctctagaaatacac
ttctatgatctgtcagaacctacggcaaatggtaccaatgggaaaaaagatgagttagca
ttaacaatgagtcgttcaatgagcaacggcagcatcatgggcatggatctggattcaagt
ggaagctctaagcaagttggcactggtttaataggactagacaatcttggaaacacatgt
ttcatgaacagtgcagtgcagtgcttagctcatacatccaagctgggtgagcttgcgtat
tcatttggggatttgttgaggaagctatgggctctggacaggacccctgttgcgcctcgc
caatttaaaggaaagcttgcgcgctttgccccccagttcagtggctttaatcaacatgat
tcccaggagcttctggctttcttgttggatggactccatgaggacttgaatcgagtgaaa
tgtaaaccatattctgaagcaaaggattcagatggccgtccagatgaagaggtcgcagat
gagtactggggaaaccatatagcccggaatgattctatcatagttgatatctgccagggt
caatacaagtcgacgttagtttgccctgattgcaggaaagtatctgtaacatttgaccca
ttcatgtacctgtctttgcccctgccttcaacaactatgagaacaatgactataacagtc
ttcaataccgatgggactactgggccatctccgtatactgtgagtgtaccgaaatctgga
gatacaaagactcttatcgatgcattaagcattgcttgttccttgaaaggcgacgagcgc
cttttggttgctgaggtctacaatagtgcacttatccggtacttggaggaaccttctgaa
gtcatctccttgatcagagatggagatcgcttggttgcatataaacttccaaaagacagt
gaagatgctccaatagtggtgttcagaaaccaacggatggagtccaccctcactagtttt
ggcagaaaatcctggaagtcttttggtacaccccttgtgtcaagtcttcctgacacaatc
aatgggagtacgatctttgagctttaccaaaaggttatgactccattccgagtaccaaaa
gatgatagttcaggtgctgaccacataattggcaaaagcagtcctgtggaggaaaccacg
gacgttgatatgaactctgatgcaacagagtcaaccagcataaacaataacgattgtgac
gatgaaacaatgactgaagatggaatgcaattttactttatcaatgagaggtttccagac
caacgcatgaagatagaaatggaccaacctattagacttactgcttcacagaagcgactg
catgtggttgacaatggactagagcaatacaattttagttctttagataatcttccagag
atctacaaggctgtcctattctcaaggagaccacaggagacatgttctctatatgcatgc
cttgaagcttttataaaggaggaaccgttaggcccagaagacatgtggtattgcccaggc
tgtaaagagcatcgccaagctagtaagaagttagacctttggaggctaccggaaatcctt
ataatacacctgaaaagattttcatacagtcgatataccaaaaacaagctagagacatgt
gtggacttcccggttcatgatcttgacctttcaaagtatatcggtagcagggggcaacag
atttccaaccactatcgactgtatgctattagtaatcactatggaagcatgggaggtggt
cactatactgcatatgtttatcatgaaggtaagaaagggtggtatgactttgatgaccgt
catgtgggtcctataagcgaggagagtataaagacatcggcagcttatgttcttttttat
aggcggatacagggggatgataataggttagatgatacagaaacaggaatagattcttct
gattgtacaacatga

DBGET integrated database retrieval system