KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266710Help
Entry
9266710           CDS       T01015                                 

Definition
Os06g0656000
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    9266710
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     9266710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 592 aa AA seqDB search
MAAIPTRLHLLLAALLVAPTLAAAQPRGFGGVVAPPPAYARYVVDAAETAAEEAYDYIVV
GGGTAGCPLAATLAGPGGGRVLVLERGGAPAEFPPLATAGGFVRTLAMADPAPESDAPAQ
TFASEDGVPNVRARVLGGATSINAGFYSRAHPDWFRSHGEGGEAMNWDMKLVNSSYEWVE
RELAFQPVVRGWQAAVRAGLLEANVTPWNGFTMDHVSGTKVGATTFDSSGRRRSAADLLA
FARPGRLRVAIRATVTRIIMSPIEPVARRGRSPQPAVAASGVVYQDRLLQQHHALLRPGG
EVILSAGSLGSPQLLLLSGIGPANDLTSLGIPVFADVPDVGKHMFDNPRNGISIIPSIPI
DHSLIQVVGIPSANGNESYLEAASYIVPLAPILRRGGPFSPSSPLYVTVVTIMEKVPGPL
SEGSLWLTSSNPLESPSVRFNYLSRREDLARCVTGMRRVAKVLESTTMDVFRSAMGSLSQ
DSRRREFRIVGAALPVDWRTNDTALGDFCQQTVATLWHYHGGCVAGSVVDRDFRVFRVRA
LRVVDGSTFRETPGTNPQATIMMMGRYIGQKMIDERHSRRQVRTSTDSSSNA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggccgccattcccacccgcctccacctcctcctcgccgctctcctcgtcgcgccaacc
ctcgccgccgcccagccccgcggtttcggaggggtggtggcgccgccgccggcgtacgcg
cggtacgtggtggacgcggcggagacggcggcggaggaggcgtacgactacatcgtggtc
gggggaggcacggcggggtgcccgctcgccgcgacgctggccgggccggggggcgggcgc
gtgctggtgctggagcggggcggcgcgcccgcggagttcccgccgctcgccaccgcgggc
gggttcgtcaggacgctcgccatggcggacccggcgcccgagtcggacgcgcccgcgcag
accttcgcctccgaggacggcgtgcccaacgtccgcgcccgcgtcctcggcggcgccacc
tccatcaacgccggcttctactcgcgcgcccaccctgactggttccgcagccacggcgag
ggtggtgaggcgatgaattgggacatgaagctagtgaattcgtcctacgagtgggtggag
cgtgaactggcgttccagccggtggtgcgtgggtggcaggcggcggtgcgtgcggggttg
ctggaagctaatgtgacgccatggaacgggtttacaatggaccatgtctctggcaccaag
gttggtgccaccacgttcgattcgtcaggccgccgccggagtgccgcagatctcctcgcc
tttgcacgccctggccgtctccgtgttgccatccgtgcgacggttactcgcatcatcatg
agcccaattgaacctgttgcacgccgtggaaggtctccacagccagcagtagcagcaagc
ggtgtcgtttaccaggaccgtcttctccagcagcaccacgcattgttgcgcccagggggg
gaggttatactttctgcaggctccctagggagtccccagttgctgctcctcagtggcatt
ggccctgccaatgatcttacatccctaggcatcccagtttttgctgatgtccctgatgtt
ggcaagcatatgtttgacaacccccgtaacggcatctccatcatcccatcaatcccaatc
gatcactcccttatccaggtagttggcattccttctgctaatgggaatgagtcctacctt
gaggctgcatcatacattgttccccttgctcccatcttacgccgtggtggtccgttcagc
ccgtcttcgccactttatgttactgtggtaaccatcatggaaaaggttcctggaccattg
tctgaaggttcactttggctcacatcatccaatcccttggagagcccttcagtgcggttc
aactacttgagccgtcgtgaggacttggcacggtgtgtgacgggcatgcggcgtgtggcg
aaagtgcttgagagcacgacaatggatgtgtttcgttcagcgatgggatcattgagccaa
gacagcaggaggagggagttcaggattgttggggctgcactgccagttgactggagaaca
aatgacacagctctgggtgatttctgccagcagactgtggcaacattatggcattatcat
ggaggatgtgtagctggaagtgtggttgacagggatttccgtgtttttcgtgtgcgtgct
cttcgtgtggtggatggatcaacattcagggaaacacctgggaccaatcctcaagccaca
atcatgatgatgggcaggtatatagggcagaagatgattgatgagcgtcacagcagaagg
caagtcagaacatcaacagattcctcttccaacgcctga

DBGET integrated database retrieval system