KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266960Help
Entry
9266960           CDS       T01015                                 

Definition
(RefSeq) 60S ribosomal protein L44
  KO
K02929  large subunit ribosomal protein L44e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Module
osa_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    9266960
Ribosome [BR:osa03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    9266960
  Archaea
    9266960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L44 RSF
Motif
Other DBs
NCBI-GeneID: 9266960
NCBI-ProteinID: XP_015646110
UniProt: Q8H5N0
Position
7
AA seq 105 aa AA seqDB search
MVNVPKTKKTYCKNKECRKHTLHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLKLQCQSCKHYSQHPIKRCKHFEIGGDKKGKGTSLF
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacgttcccaagaccaagaagacctactgcaagaacaaggagtgcaggaagcac
acccttcacaaggtcactcagtacaagaagggtaaggacagcctgtctgcccagggaaag
cgccgttatgaccgaaagcagtcaggatatggtggtcagaccaagcctgttttccacaag
aaggcaaaaaccaccaagaagatcgtgctgaagctgcaatgccaaagctgcaagcattac
tcccagcaccccatcaagaggtgcaagcatttcgagattggtggagacaagaagggcaag
ggaacatctcttttctaa

DBGET integrated database retrieval system