KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268195Help
Entry
9268195           CDS       T01015                                 

Definition
Os09g0570850
Orthology
K11252  
histone H2B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9268195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 194 aa AA seqDB search
MAPKQKEAANKKKKKKEVAVLVKTKTKVVQLTTTTAELELEPTVTVQVDDNKTGAAADET
PPVVPLQSQETQDPNEPKAAAAKKKKRAGHGRKRSRRRRGGALEYGGYKRYVWRVLKQVH
PDLGASAQTMDVLDMMMADMFERLADEASRLSKLSGRLTLTSREVQSAVRLVLPADLANH
AISEGTKAISNYLS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaagcagaaggaggcagcgaacaagaagaagaagaagaaggaggtggcagtg
ttggtgaagaccaagaccaaggtggtgcagctcaccaccaccaccgcggagctggagctg
gagcccactgtcactgtgcaggtggacgacaacaagacgggtgcagctgcagatgagacg
ccgccggtggtgccgctgcagagccaagagacgcaggaccccaacgagcccaaggcggcg
gcagcgaagaagaagaagcgcgcggggcatggaagaaaaaggagtaggaggaggagaggc
ggtgcattggagtatggcgggtacaagaggtacgtgtggcgcgtgctgaagcaggtgcac
cctgacttgggcgcctccgcccaaaccatggacgtcctcgacatgatgatggccgacatg
ttcgagcgcctcgccgacgaggcctctcgcctctccaagctctccggccgcctcaccctc
acctcccgtgaggttcagtccgccgtccgcctcgtcctccccgccgacctcgccaaccac
gccatctccgagggcaccaaggccatctctaactacctttcctaa

DBGET integrated database retrieval system