KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268563Help
Entry
9268563           CDS       T01015                                 

Definition
(RefSeq) uncharacterized protein LOC9268563 isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    9268563
   00500 Starch and sucrose metabolism
    9268563
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     9268563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5052
Motif
Other DBs
NCBI-GeneID: 9268563
NCBI-ProteinID: XP_015612574
Position
9
AA seq 346 aa AA seqDB search
MAEELLITSSLQRTGRMIRMMDRLVRLHYGGSVVEQSNSGSNFEGMSVKQLIFGGKPSFE
ELVCHTKDVLGWSNQSIAIQGRYDVGAGPISHKYMLDLNGELEWNTYVDIVLGSQFKSLE
VVASKLDRTDCRDNSFDLNRTLFYDEPNYEAFDDEGAMKSQSVKSLTVEEVIESQGMGVD
VNMQKKEAVDANEGRSQESERVEINVELQKEEAVEANKASRLESEGVEVNVELQKEEAIE
VNEARSQAVPIVGNHVDDDNELADGSMGAGGEERTTDAQLASMVRFYFQDKIYTRRECEE
TLLMNGLSVDLLHKHSEEYDDTHEEEGYEVEYAVDLDDDRPVAKMS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaactgcttatcacttccagcctgcaaagaactggcagaatgatccgaatg
atggatagattagtacgattgcactatggtggttcggtggtagagcaaagtaacagtggt
agcaatttcgaggggatgagtgttaagcaacttatatttggtggaaaacctagttttgag
gagttagtttgtcatacaaaggatgtgctggggtggagcaatcagtctatagctatacaa
ggtagatatgatgttggagcaggacccatttcacacaagtacatgctagatttgaatggg
gagttggagtggaacacatatgtggatatagtgttgggctcccaattcaagtcgcttgag
gtggttgcttcgaagcttgatcgtactgactgcagagataattcttttgacctcaatcgc
acactgttttatgatgaaccaaactatgaagcatttgatgatgaaggagctatgaaaagt
cagtcggttaagtctttgacagttgaggaagtcatagaatctcaagggatgggggtggat
gttaacatgcaaaagaaggaagcagttgatgcgaatgagggaaggagtcaggaatctgaa
agggtggagataaatgtggagttgcagaaggaggaagcagttgaggctaataaggcaagc
aggcttgaatcagaaggcgtggaggtaaatgtggaattgcagaaggaggaagcaatagag
gtgaatgaggcaaggagtcaggcagttccgatagttggaaatcatgttgatgatgataat
gaattggcagatggatcaatgggggcaggtggagaagagcgtacaacggatgctcaatta
gcatccatggtgcggttctattttcaagacaaaatatatactcggagggagtgtgaggag
actttgttgatgaatggattgagtgttgatttgctgcacaaacattcagaggagtatgat
gacacacatgaggaggagggatatgaggttgagtatgccgtagacttagatgacgatcgt
ccagtagccaagatgtcttag

DBGET integrated database retrieval system