KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270404Help
Entry
9270404           CDS       T01015                                 

Definition
Os11g0573000
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     9270404
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   9270404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 290 aa AA seqDB search
EVAVRKMVDYWTYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDM
PSGSIPLALQSLFYKLQYSDNSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKM
KRTVVEGTIEKLFEGHHINYIECINVDYKSNRKESFYDLQLDVKGCRDVYASFDKYVEVE
RLEGDNKYHAENHGLQDAKKGVLFLDFPPVLQLQLKRFEYDYMRDTMVKINDRYEFPLQL
DLDRDDGKYLAPDADRSIRNLYALHSVLVHSGGVHGGHYYAFIRPTLSDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gaggttgctgtccgcaaaatggttgattattggacatatgattcaaaaaaagaaacaggt
tacgttggcctgaagaaccaaggagctacctgttacatgaactctctactacagacacta
taccatataccatacttcaggaaggctgtgtatcatatgccaaccaccgaaaatgatatg
ccatctgggagtattccgttggcattgcagagccttttctacaagctccagtatagtgac
aatagtgtagccaccaaagagctgaccaaatcttttggatgggacacatatgattccttc
atgcaacatgatgtacaagagctcaacagagttctctgtgagaaacttgaagataagatg
aagagaactgtcgtagagggaacgattgaaaagttattcgaaggtcaccacatcaattat
atagagtgtataaatgttgactataaatccaacaggaaggagtccttttatgaccttcaa
cttgatgttaaaggttgtcgtgatgtgtatgcatcgtttgataaatatgttgaagttgag
cgcctcgaaggtgataataagtatcatgcagagaatcatggtttacaggatgcgaaaaag
ggtgttctgttccttgatttccccccagttttgcaacttcaactgaagcgttttgagtac
gactatatgagagataccatggttaagattaatgaccgctatgaattccctttgcaactt
gatttggatagagatgatggaaaatatcttgctccagatgcagatagaagtataagaaac
ctttatgctcttcacagtgttcttgttcatagtggaggagtacatggcggtcactactat
gccttcattcgaccaacgctatcagatcaatga

DBGET integrated database retrieval system