KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270728Help
Entry
9270728           CDS       T01015                                 

Definition
Os11g0201400
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     9270728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 461 aa AA seqDB search
MATGGNSLPSPSCADDKKRRVCYYYDPGIAHIKFSDDHVMVPARVAMAHSLVGVYGMLGD
MSRLRTRPATEAEIRRFHSPEYVDLLRDLTPESYFNDAALRQKAEDDHGIGGKDDCPAFD
RLWKYCRGYAGGSLAAARALVDGASDIAINWSGGMHHASACKATGFCYVNDIVLAINELL
GTFRRVIYVDIDAHHGDGVQNAFLDSNRVMTLSFHRYGKITPHKNFFPGSGAINEIGAGA
GEHYSVNVPLDAGVRADAMEVFQPEAIVLQCGADSLSGDRLGGMELSVRGHAECVGFLRG
FNLPLLLVGGGGYTINHVASTWCYETAVAVGKERELPDDIEIPSHGYELMYKNQGDKLHY
QKSTATAARKRSSSAEVTKGKVLEHLSQIERAPSVQFQERRGGNNAAGVELYYDRPPSLE
DDEPAQRLHRLCFPGLTKRIKLRWCLVEVRKCKRKWDQLQR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccaccggggggaactcgctgccgtcgccgtcgtgcgccgatgacaagaagcggcgg
gtgtgctactactacgacccgggcatcgcccacatcaaattcagcgacgaccatgtcatg
gtgcccgcccgcgtcgccatggcgcacagcctcgtcggcgtctacggcatgctcggcgac
atgagccgcctccgtacgagacccgccacggaggcggagatccgccgcttccactcgccg
gagtacgtcgacctcctccgcgacctcaccccggaaagctacttcaacgacgccgcgctt
cggcagaaggcggaggatgaccacggcatcggcggcaaagatgattgccccgccttcgac
cgcctctggaagtactgccgcggctacgccggcgggtcgctcgccgcggcgcgcgcgctc
gtcgacggcgcctccgacatcgccatcaactggtcaggcggcatgcaccacgcgtccgcc
tgcaaggccaccggcttctgctacgtcaacgacatcgtgctcgccatcaacgagctcctc
ggcaccttcaggcgagtcatctacgtcgacatcgacgcgcaccacggcgacggcgtgcag
aacgccttcttggactccaaccgggtcatgacgctgtcgttccaccggtacggcaaaatc
acgccccacaagaacttcttcccgggctccggcgccatcaacgaaatcggcgccggcgcc
ggcgagcactacagcgtgaacgtgcccctggacgccggcgtccgcgccgacgccatggag
gtgttccagccggaggccatcgtgctgcagtgcggcgccgactcgctctccggcgaccgc
ctcggcggcatggagctgtcggtgcggggccacgcggagtgcgtcggcttcctccgcggg
ttcaacctgccgctgctcctcgtcggcggcggcggctacaccatcaaccacgtcgcatcc
acgtggtgctacgagacggcggtcgccgtcggcaaggagagggagctccccgacgacata
gagatacccagccacggctacgagctcatgtacaagaaccagggggacaagctccattac
cagaagtcgacagcgacggcggcgagaaagaggtcgagcagcgcggaggtcaccaagggg
aaggtgctcgagcacctgtcgcagatcgagcgcgcgccgagcgtgcagttccaggagcga
cgcggcggcaacaatgccgccggagttgagctctactacgaccgccctccgagcctggaa
gacgacgaacccgcgcagaggctgcaccggctctgcttccccggcctgacgaagcgtatt
aagcttaggtggtgtttggttgaggtcaggaaatgcaaacgtaaatgggatcagctacag
cggtaa

DBGET integrated database retrieval system