KEGG   Odoribacter splanchnicus: Odosp_0032Help
Entry
Odosp_0032        CDS       T01428                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
osp  Odoribacter splanchnicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_0032
   00052 Galactose metabolism
    Odosp_0032
Enzymes [BR:osp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Odosp_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36330..37469
Genome map
AA seq 379 aa AA seqDB search
MKTFVLGLVVVAGIMSSCSPKAKEETTLSGLNPKKFQAEIDGKQAGLYTLKNSAGMEVCI
TNFGGRIVSVLVPDKHGNRKDVVLGFDSLADYRNIPSDFGASIGRYANRIAQGRIEIDGE
TIQLPQNNYGHCLHGGPEGWQYQMYEANQIDGTTLELTRFSPDGDQNFPGNVRAKVRFHL
TDDNAIDIQYEAVTDKKTVINMTNHSYFNLSGNPAVAATDHLLYVNADGYTPVDSTFMTT
GEIVPVAGTPMDFIQPKEIGREIDRYDFVQLKNGNGYDHNFVLNTKGDLSTVAARLSSPE
SGIVLEVYTDEPGIQVYTGNFLDGTVKGKKGVVYNQRASVCLETQHFPDSPNKPRWPSVY
LEPGQTYSSRCIYKFSVEK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtttgtattgggtttggtggttgttgcaggaatcatgagttcttgttcccca
aaagcaaaggaagagacaactctttccggactgaatccgaagaagtttcaggcagagatc
gatgggaaacaggccggtctctatactttgaagaattcggccggaatggaagtttgtatc
actaatttcggtggccgtatcgtgtctgttttggttccggataaacatggaaataggaaa
gatgtggtattgggtttcgatagtttggcagattatcggaatatacccagcgattttgga
gcctctatcggtcggtatgctaaccggattgcacaggggagaatcgaaatcgatggcgaa
actattcaattgccgcagaataactatggacattgtttacacggggggccggaaggttgg
caatatcagatgtatgaagctaatcagatcgatggtacgactctcgaactgacccgtttt
tctccggatggcgatcagaatttccctgggaatgtacgggcgaaagtgcgctttcatctt
acagatgataatgctatcgatattcagtacgaggctgtgacagataagaaaacggtgatc
aatatgacgaatcactcttatttcaatttgtcgggtaatccggctgttgccgctacggat
catttgttgtatgtgaatgcggatgggtatactccggtcgacagtacctttatgacaacg
ggtgagatcgttccggtggccggaacgcctatggacttcattcaaccgaaagaaatcgga
cgggagatagaccgttatgattttgttcagttgaaaaatggaaacggttacgaccataat
tttgtattgaacactaaaggagatctttctactgtcgctgcccgtttgtcttcgcctgag
tccggtatagtactcgaggtatatacggatgagcccggtattcaggtgtataccggtaac
ttcctcgatggaactgtgaaagggaaaaaaggggtcgtttataaccaacgggcttctgtt
tgcctggaaacacaacattttcccgattctccgaacaaaccccgatggccgtctgtttac
ctggaaccggggcagacttattccagtcgttgtatctataaattttctgtagagaaataa

DBGET integrated database retrieval system