KEGG   Odoribacter splanchnicus: Odosp_0166Help
Entry
Odosp_0166        CDS       T01428                                 

Definition
Glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
osp  Odoribacter splanchnicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Odosp_0166
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_0166
   00052 Galactose metabolism
    Odosp_0166
   00500 Starch and sucrose metabolism
    Odosp_0166
   00520 Amino sugar and nucleotide sugar metabolism
    Odosp_0166
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Odosp_0166
   00524 Butirosin and neomycin biosynthesis
    Odosp_0166
Enzymes [BR:osp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Odosp_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(189191..190153)
Genome map
AA seq 320 aa AA seqDB search
MKKDVALGIDIGGTNTAFGFIDREGNYLTEGNIPTAKHEDINDYLKELYLEIEKVLDPIR
QEVNFVGIGIGAPNGNYFKGAIEFAPNLPWHDVIPLCDMMKEYYPELPVYLNNDAKAAAI
GEMIYGGAQGMKNFIMVTLGTGLGSGFVVNGELVYGHDGFAGELGHTIVSPNGRQCGCGR
SGCLETYVSATGVKRTAYKMMAKYNYPSELRSIPFNEMNAKIVSEAAQKGDMIAINTFKY
TGKMLGEALANAVAITSPEAIFLMGGLAKAGDLLFEPVKDHMEMNLLKIYSNKVKILPSK
LTKNVAIYGAAALVWKELEK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagacgtcgctttagggattgacatcggtggtaccaacaccgcttttggtttt
atcgacagagaagggaactaccttacagaagggaacatcccgacagctaaacatgaagat
atcaacgattatctgaaagaattatatctggaaatcgaaaaagtactggatcctatccgc
caggaagtcaactttgtaggaatcggaatcggagcacccaatggtaattacttcaaagga
gcgatcgaatttgcaccgaacctgccttggcacgatgtcattcctttgtgcgatatgatg
aaagaatactatcccgaactgccggtttatctgaacaacgacgccaaagctgcagctatc
ggtgaaatgatttacggcggtgcccaagggatgaaaaatttcatcatggtcactttaggt
accggtctgggtagtggattcgtagtcaacggcgaattggtttacggacacgacggcttt
gccggagaactcggtcataccatcgtttctcccaacggccgccaatgtggttgcggacgt
agcggttgtctggagacctatgtatctgccacgggagtaaaacgcaccgcttataaaatg
atggctaaatataactatccgagcgaattgagatccatccctttcaatgaaatgaatgcg
aaaatcgtaagcgaagctgcacaaaaaggcgatatgatcgctatcaatactttcaaatat
accggaaaaatgctgggtgaagctttggccaacgccgttgccatcaccagcccagaagcc
atcttcctgatgggaggcctggccaaagccggcgacctgcttttcgaaccggtaaaagat
catatggaaatgaatcttttgaagatttatagcaataaagtcaaaatcttaccttctaaa
ctgactaagaatgtcgccatttacggagctgctgctttagtctggaaagagctggaaaaa
taa

DBGET integrated database retrieval system