KEGG   Odoribacter splanchnicus: Odosp_0235Help
Entry
Odosp_0235        CDS       T01428                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00010  Glycolysis / Gluconeogenesis
osp00052  Galactose metabolism
osp01100  Metabolic pathways
osp01110  Biosynthesis of secondary metabolites
osp01120  Microbial metabolism in diverse environments
osp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_0235
   00052 Galactose metabolism
    Odosp_0235
Enzymes [BR:osp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Odosp_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADY31340
UniProt: F9Z3P8
Position
complement(272227..273366)
Genome map
AA seq 379 aa AA seqDB search
MKKRLLIVCCALCSLMACNSKTDTGTTLSGLKKADFDTTVSGKKVALYELKNKNGVEVAI
TNYGGRIVSIWVPDRNGKFGDIMLAHSSIADYIADQGGNFGALIGRYGNRINQGRFILDG
QEYQLPQNNYGHCLHGGDTGFHHRIWDATQPNAQTLVLSCVSPDGEAGFPGTLKTTVTYS
LSDDNALQINYEAETDKPTIVNLTNHAYFNLSGDGKTTILDHQLTLNADYYTPVDSTFMT
TGEIAPVEGTPMDFRTATAIGARIDNYDFEQLKNGHGYDHNYVLNTQGDISQVAAKVYDP
KSGRTLEVYTNEPGIQFYAGNFLDGTVKGKHGIYYPLRSALCLETQHYPDSPNKADWPSV
VVRPGEKYHSTCIYKFGAE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagattactcatcgtatgctgtgcattgtgctctctgatggcttgtaacagc
aagaccgatacgggcacgaccttatccggattaaagaaagcagatttcgacacgacggtt
tccggaaaaaaagtcgctttatacgaactgaaaaacaaaaatggtgtagaggtagcgatc
acgaactacggaggtcgtatcgtttctatttgggtacccgaccggaacggcaagttcggt
gacatcatgctggcccacagttctatcgccgattatatcgccgaccaaggtggtaatttc
ggagctctgatcggacgctatggtaaccggatcaatcagggacgttttatcctggacggc
caggaataccaattgcctcaaaataattacggtcactgcttacacggaggcgacaccgga
tttcatcaccggatttgggatgcaacccaacccaatgcccagacattagtcctgagctgt
gtttctcccgacggagaagccggttttccgggaacgctgaaaacaacggttacttacagc
ttgtccgacgacaatgctcttcagatcaactatgaagcagaaaccgacaaaccgacgatc
gtcaatctgaccaatcatgcttatttcaacctatcaggagatggcaaaaccaccattctg
gatcatcagttgacgctgaatgccgattattatactccggtggacagtacgtttatgact
accggcgaaatcgcaccggtcgaaggtactccgatggatttccggacagcaaccgcaatc
ggtgccagaatcgataattacgatttcgaacaattgaaaaacggtcacggctacgaccac
aactacgttttgaacacccaaggcgacatcagccaagttgcagctaaagtgtacgacccc
aaaagcggacgtactctggaagtatataccaacgaaccgggtattcaattttatgccggc
aatttcctcgacgggactgtaaaaggtaaacacggtatttactatcccttacgttctgct
ctttgcctggaaacacaacactatcccgattcccccaacaaagccgactggccttcggtt
gtcgtacgtccgggagaaaaatatcatagcacctgtatttataaattcggtgcagaataa

DBGET integrated database retrieval system